Recombinant Mouse Retinal dehydrogenase 1(Aldh1a1)

Code CSB-YP001565MO
Product Type Recombinant Protein
Size US$2959
Uniprot No. P24549
Relevance In addition to the activity on acetaldehyde and related substrates, is also involved in the oxidation of aldehydes derived from biogenic amines such as epinephrine and norepinephrine, as well as the aldehydes generated via lipid peroxidation. Binds free retinal and cellular retinol-binding protein-bound retinal. Can convert/oxidize retinaldehyde to retinoic acid
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias ALDH-E1 ALHDII Aldehyde dehydrogenase family 1 member A1 Aldehyde dehydrogenase, cytosolic
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTVAMKISQKNS
Research Area Cancer
Source Yeast
Gene Names Aldh1a1
Protein Names Recommended name: Retinal dehydrogenase 1 Short name= RALDH 1 Short name= RalDH1 EC= 1.2.1.36 Alternative name(s): ALDH-E1 ALHDII Aldehyde dehydrogenase family 1 member A1 Aldehyde dehydrogenase, cytosolic
Expression Region 2-501aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 56.3kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Can convert/oxidize retinaldehyde to retinoic acid. Binds free retinal and cellular retinol-binding protein-bound retinal (By similarity). May have a broader specificity and oxidize other aldehydes in vivo (By similarity).
Subcellular Location Cytoplasm, cytosol
Protein Families Aldehyde dehydrogenase family
Tissue Specificity Expressed in the liver, lung, and testis. Apparently not expressed at detectable levels in kidney, stomach, ovary, heart, and brain.
Database Links

KEGG: mmu:11668

STRING: 10090.ENSMUSP00000084918

UniGene: Mm.250866

Related Products

Aldh1a1 Antibodies

Aldh1a1 Antibodies for Mouse

Aldh1a1 Antibodies for Mus musculus (Mouse)

Aldh1a1 Proteins

Aldh1a1 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.