Name: Recombinant Mouse Scavenger receptor cysteine-rich type 1 protein M130 (Cd163), partial
Brand: CUSABIO
SKU: CSB-EP650452MO

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Cd163

Uniprot No.

Q2VLH6

Research Area

Others

Alternative Names

Cd163; M130Scavenger receptor cysteine-rich type 1 protein M130; CD antigen CD163) [Cleaved into: Soluble CD163; sCD163)]

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

86-365aa

Target Protein Sequence

VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

34.2kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

We are pleased to introduce our newest product, the Recombinant Mouse Cd163. This scientifically engineered protein closely mimics the naturally occurring Scavenger receptor cysteine-rich type 1 protein M130, also known as Soluble CD163. This makes it an excellent tool for research studies aimed at understanding the function of this crucial protein in the mouse system.

Expressed in an E.coli system, the Recombinant Mouse Cd163 represents a partial protein length that includes the amino acids from position 86 to 365. Equipped with an N-terminal 6xHis-tag, this feature aids in effective protein purification and detection. The product's purity has been ascertained to be greater than 90% as per SDS-PAGE, ensuring a high-quality product for your research. You can select from either a liquid or lyophilized powder form based on your experimental needs.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We're looking for the soluble CD163 for mouse.
According to the mouse sequence the extracellular domain is aa39-1045 which is probably too long to make?
http://www.uniprot.org/uniprot/Q2VLH6
I see that CSB-EP650452MO corresponds to sequence 86-365aa but do you have anything longer?
Please can you suggest the proteins for both human and mouse that are the closest you can come to this request?
Thank you

Thanks for your inquiry. Soluble CD163 recombinant protein for mouse
Yes, we can provide mouse CD163 protein which corresponds to 86-365aa, please check the details as follows:
Recombinant Mouse Scavenger receptor cysteine-rich type 1 protein M130(Cd163),partial
CSB-EP650452MO >> E.coli
You can view the information of this product on this page in details.
This YP protein has been successfully expressed and has been ordered many times by other customers, what we provide is the soluble form, we can send you the COA of the latest batch for your reference.
For the time being, we have only tried the above expression region of 86-365aa, if you need longer sequence, you can tell us the specific sequence or expression region, we can try custom service for you, and the lenghth of sequence within 800aa is risk-free service.
Below is the custom service of extracellular domain (aa39-1045) of mouse soluble CD163 recombinant protein. Since its length is over 800aa, we will charge according to different steps.
Product Name:Recombinant Mouse Scavenger receptor cysteine-rich type 1 protein M130(Cd163),partial
Expression region:39-1045aa; Partial, provide the complete extracellular domain.
Tag information: Tag type will be determined during the manufacturing process.
We can try to express your desired tag first if you have special request for the tag, but as we can't guarantee, if it's failed, we can provide protein with other tag.
Sequence:

VTNAPGEMKKELRLAGGENNCSGRVELKIHDKWGTVCSNGWSMNEVSVVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCSDGADLELRLVGGGSRCAGIVEVEIQKLTGKMCSRGWTLADADVVCRQLGCGSALQTQAKIYSKTGATNTWLFPGSCNGNETTFWQCKNWQWGGLSCDNFEEAKVTCSGHREPRLVGGEIPCSGRVEVKHGDVWGSVCDFDLSLEAASVVCRELQCGTVVSILGGAHFGEGSGQIWGEEFQCSGDESHLSLCSVAPPLDRTCTHSRDVSVVCSRYIDIRLAGGESSCEGRVELKTLGAWGPLCSSHWDMEDAHVLCQQLKCGVAQSIPEGAHFGKGAGQVWSHMFHCTGTEEHIGDCLMTALGAPTCSEGQVASVICSGNQSQTLLPCSSLSPVQTTSSTIPKESEVPCIASGQLRLVGGGGRCAGRVEVYHEGSWGTVCDDNWDMTDANVVCKQLDCGVAINATGSAYFGEGAGAIWLDEVICTGKESHIWQCHSHGWGRHNCRHKEDAGVICSEFMSLRLTNEAHKENCTGRLEVFYNGTWGSIGSSNMSPTTVGVVCRQLGCADNGTVKPIPSDKTPSRPMWVDRVQCPKGVDTLWQCPSSPWKQRQASPSSQESWIICDNKIRLQEGHTDCSGRVEIWHKGSWGTVCDDSWDLNDAKVVCKQLGCGQAVKALKEAAFGPGTGPIWLNEIKCRGNESSLWDCPAKPWSHSDCGHKEDASIQCLPKMTSESHHGTGHPT

Reference:http://www.uniprot.org/uniprot/Q2VLH6
The Cat No for each expression system is listed as follows:
CSB-YP650452MO1 >> Yeast
CSB-EP650452MO1 >> E.coli
CSB-BP650452MO1 >> Baculovirus
CSB-MP650452MO1 >> Mammalian cell
If we can successfully express this protein, you could pay the corresponding fees and we will provide the purified protein.
If we are failed in expression this protein, you need to pay for the gene synthesis and subcloning and we will provide the constructed plasmid and strains.
PS: The expression plasmid is not for sale if this project is successful.

Target Background

Function

Involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1.; After shedding, the soluble form (sCD163) may play an anti-inflammatory role.

Gene References into Functions

house dust mite -challenged Cd163-/- mice displayed increases in airway eosinophils and mucous cell metaplasia PMID: 26376364
In diabetic mice, increased sCD163 at wk 5 and decreased percentage of CD163(+) monocytes at wk 10 preceded alteration in kidney collagen IV mRNA at wk 20. In vitro incubation of monocytes in anti-inflammatory glucocorticoid increased the percentage of CD163(+) monocytes. PMID: 27354410
During ischaemia, soluble CD163 functions as a decoy receptor for TWEAK, to regulate TWEAK-induced activation of canonical nuclear factor-kappaB and Notch signalling necessary for myogenic progenitor cell proliferation. PMID: 26242746
Data indicate an essential substrate motif for ADAM17-mediated CD163 and proTNF-alpha cleavage in macrophages. PMID: 24275664
alpha(1)-Acid glycoprotein up-regulates CD163 via TLR4/CD14 protein pathway: possible protection against hemolysis-induced oxidative stress. PMID: 22807450
Data show that telmisartan reduced the mRNA expression of CD11c and TNF-alpha, M1 macrophage markers, and significantly increased the expressions of M2 markers, such as CD163, CD209. PMID: 21427223
Assignment of the CD163 antigen to mouse chromosome 6 band F2. PMID: 12698011

Hide All

Subcellular Location

[Soluble CD163]: Secreted.; Cell membrane; Single-pass type I membrane protein.

Tissue Specificity

Expressed in monocytes and mature macrophages such as Kupffer cells in the liver, red pulp macrophages in the spleen and mesenteric lymph nodes.

Database Links

KEGG: mmu:93671

STRING: 10090.ENSMUSP00000108160

UniGene: Mm.37426

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address