Recombinant Mouse Secretoglobin family 3A member 2 (Scgb3a2)

In Stock
Code CSB-EP846028MO
Abbreviation Recombinant Mouse Scgb3a2 protein
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Scgb3a2
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Scgb3a2; Pnsp1; Ugrp1; Secretoglobin family 3A member 2; Pneumo secretory protein 1; PnSP-1; Uteroglobin-related protein 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
22-139aa
Target Protein Sequence
LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.2kDa
Protein Length
Full Length of Mature Protein of Isoform C
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Mouse Scgb3a2 can be used in Epigenetics and Nuclear Signaling research. It represents a precise replication of the mature Secretoglobin family 3A member 2 protein, also known as Pneumo secretory protein 1, PnSP-1, or Uteroglobin-related protein 1, as expressed in isoform C. It's a product of diligent scientific endeavor, aimed at supporting in-depth exploration of molecular signaling pathways.

The Recombinant Mouse Scgb3a2 is a product of E.coli expression system and includes the complete protein length from the amino acid 22 to 139. It features an N-terminal 6xHis-GST-tag, which facilitates effective protein detection and purification. The purity level of the product is assured to be more than 90%, as determined by SDS-PAGE, promising a high-quality, consistent research output. You can select to receive this product either in liquid form or as a lyophilized powder, according to your specific laboratory requirements.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secreted cytokine-like protein. Binds to the scavenger receptor MARCO. Can also bind to pathogens including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Strongly inhibits phospholipase A2 (PLA2G1B) activity. Seems to have anti-inflammatory effects in respiratory epithelium. Also has anti-fibrotic activity in lung. May play a role in fetal lung development and maturation. Promotes branching morphogenesis during early stages of lung development. In the pituitary, may inhibit production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH).
Gene References into Functions
  1. These results demonstrate that SCGB3A2 has an anti-inflammatory activity in the HDM-induced allergic airway inflammation model, in which SCGB3A2 may modulate the CCR4-CCL17 pathway. PMID: 27820933
  2. The pulmonary fibrosis in the Scgb3a2-null mice was more severe than the wild-type controls, thus establishing that SCGB3A2 has anti-fibrotic activity in vivo. PMID: 26559674
  3. SCGB3A2 is an anti-fibrotic agent, and suggest a possible therapeutic use of recombinant SCGB3A2 in the treatment of pulmonary fibrosis. PMID: 26178733
  4. The results indicate that the loss of SCGB3A2 function was influenced by a modifier gene(s) in mixed genetic background and suggest that SCGB3A2 has anti-inflammatory property. PMID: 25242865
  5. SCGB3A2 regulates FSH/LH production in the anterior pituitary lobe. PMID: 24514953
  6. Secretoglobin 3A2 suppresses bleomycin-induced pulmonary fibrosis by transforming growth factor beta signaling down-regulation PMID: 21478551
  7. Results demonstrate that SCGB3A2 is a useful marker for diagnosis of pulmonary tumors both in mice and humans. PMID: 20466451
  8. UGRP1 does not play a major role in the development of bronchial asthma in our Caucasian population. PMID: 12915772
  9. results demonstrate that interleukin-10 induces uteroglobin related protein 1(UGRP1) gene expression in lung epithelial cells through transcription factor T/EBP/NKX2.1-dependent pathway PMID: 15485815
  10. UGRP1 is downregulated in inflamed airways, such as allergic asthmatics. PMID: 15531759
  11. To assess a potential role for SCGB3A2 during early lung development, wild-type and Nkx2-1-null fetal lungs of early developmental stages were subjected to ex vivo organ culture in the presence of SCGB3A2. PMID: 18535256
  12. C/EBPalpha and C/EBPdelta have a role in the synergistic interaction with NKX2-1 in mouse Scgb3a2 gene transcription and lung development PMID: 18632661
  13. SCGB3A2 gene may contribute to Graves' disease susceptibility. PMID: 19126779

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Secretoglobin family, UGRP subfamily
Tissue Specificity
Highly expressed in lung where it localizes to epithelial cells of the trachea, bronchus and bronchioles (at protein level). Expressed in club/Clara cells of the bronchioles. Also detected in the anterior and posterior lobes of the pituitary gland where i
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*