Recombinant Mouse Stanniocalcin-2 (Stc2)

In Stock
Code CSB-EP022822MO
Abbreviation Recombinant Mouse Stc2 protein
MSDS
Size $554
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Stc2; Stanniocalcin-2; STC-2
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
25-296aa
Target Protein Sequence
TDSTNPPEGPQDRSSQQKGRLSLQNTAEIQHCLVNAGDVGCGVFECFENNSCEIQGLHGICMTFLHNAGKFDAQGKSFIKDALRCKAHALRHKFGCISRKCPAIREMVFQLQRECYLKHDLCSAAQENVGVIVEMIHFKDLLLHEPYVDLVNLLLTCGEDVKEAVTRSVQAQCEQSWGGLCSILSFCTSNIQRPPTAAPEHQPLADRAQLSRPHHRDTDHHLTANRGAKGERGSKSHPNAHARGRTGGQSAQGPSGSSEWEDEQSEYSDIRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant Mouse Stc2 protein in e.coli cells is a multi-step process, including constructing the expression vector coding for the Mouse Stc2 protein (25-296aa), transforming the recombinant vector into e.coli cells, selecting the cells that containing the vector and cultivating them, performing cell lysis, collecting the protein, and characterizing the protein. The resulting recombinant Mouse Stc2 protein is purified from the cell lysate through affinity purification, and its purity, determined by SDS-PAGE, is greater than 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has an anti-hypocalcemic action on calcium and phosphate homeostasis.
Gene References into Functions
  1. results in MTA2 recruitment to the Stc2 promoter, concomitant with agonist-specific epigenetic modifications targeting histone H4 lysine acetylation PMID: 28696214
  2. STC2 is involved in regulating PAPP-A activity during the development of atherosclerosis PMID: 26983002
  3. Stanniocalcin-2 inhibits proteolytic release of IGF and its ability to cause growth retardation upon transgenic overexpression in mice depends on its proteinase inhibitory function. PMID: 25533459
  4. The Stc2 promoter contains multiple putative xenobiotic response elements. PMID: 23269473
  5. These results suggest that the up-regulation of STC2 gene expression resulting from abnormal alpha-klotho-Fgf23 signaling may contribute to limitation of ectopic calcification. PMID: 22285620
  6. These results define a novel molecular function for STC2 as a negative modulator of Store-Operated Calcium Entry and provide the first direct evidence for the regulation of Ca2+ homeostasis by mammalian STC2. PMID: 21746875
  7. STC2 is linked to PERK signalling in acinar cells and has a role in limiting damage during pancreatic injury. PMID: 21545732
  8. induced STC2 expression is an essential feature of survival component of the unfolded-protein response PMID: 15485913
  9. The murine stanniocalcin 2 gene is a negative regulator of postnatal growth. PMID: 18258678

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Stanniocalcin family
Tissue Specificity
Found in a variety of tissues including skeletal muscle, small intestine, kidney, liver and brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*