Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial

In Stock
Code CSB-EP004931MOc7
Abbreviation Recombinant Mouse Cd3e protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
T-cell surface antigen T3/Leu-4 epsilon chain;CD antigen CD3e
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
23-108aa
Target Protein Sequence
DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.5
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.
Gene References into Functions
  1. The data show that CD3epsilon chain couples to Cbl via simultaneous binding of both proteins to Numb, thus mediating TCR degradation PMID: 26507128
  2. IL-17-producing CD3(bright) gammadelta T cells responded promptly and strongly to pneumococcal infection and during skin inflammation. PMID: 25385067
  3. these results suggest that CD3zeta can be degraded by two pathways: SLAP/c-Cbl, which targets internalized cell surface CD3zeta dependent on TCR signaling, and LAPTM5, which targets intracellular CD3zeta independent of TCR signaling. PMID: 24638062
  4. these results indicate that membrane association of the CD3epsilon signaling domain is required for optimal thymocyte development and peripheral T cell function. PMID: 24899501
  5. These results suggest that proteasome-mediated degradation is involved in hypophosphorylated LAT and PLCgamma1 in Dow2-induced anergic T cells. The novel CD3-specific Ab, Dow2, may provide us with a unique tool for inducing immunosuppression PMID: 24595757
  6. that Nck recruitment to the TCR is fundamental to mount an efficient T cell response in vivo, and that the Nck-CD3epsilon interaction may represent a target for pharmacological modulation of the immune response. PMID: 24470497
  7. Structure of murine CD3epsilon complexed with the mitogenic anti-CD3epsilon antibody 2C11 enabled structural comparisons of antibody-liganded and unliganded forms of CD3epsilon revealing that antibody binding does not induce any substantial rearrangements within CD3epsilon. PMID: 22262845
  8. CFTR dysfunction in T cells can lead directly to aberrant immune responses in CD3+ lymphocytes PMID: 20724552
  9. analysis of the transgenic integration site in immunodeficient tgepsilon26 human CD3epsilon transgenic mice PMID: 21203507
  10. Polymorphisms of the CD3varepsilon ectodomain exist in mice,some of which lead to amino acid substitutions which cause structural changes and affect anti-CD3 antibody binding. PMID: 20638133
  11. the stalks of the CD3 proteins may be critical in transmitting part of the activation signal directly through the membrane. PMID: 19956738
  12. Results suggest that generation of CD3varepsilon chain isoforms with different N-terminal sequence and pI is a general phenomenon. PMID: 19616027
  13. We demonstrate that the intra-cytoplasmic (IC) domain of CD3epsilon plays a critical role in regulating TCR expression on DP thymocytes. PMID: 19819936
  14. inability of Nck to bind to the CD3epsilon proline-rich sequence in thymocytes after TCR ligation PMID: 15972658
  15. That CD43 costimulation was responsible for elevated cytokine/chemokine activity was confirmed at the transcriptional level by real-time PCR for IFN-gamma and CCL5, and by ELISA for IFN-gamma. PMID: 16246302
  16. insulin-specific Tregs producing IL-10, TGF-beta, and IL-4 are enhanced by suppression of CD3epsilon in a mouse model of autoimmune diabetes PMID: 16628253
  17. GRK2 is primarily involved in arresting G protein-coupled receptor signals, its interaction with CD3 epsilon may provide a novel means whereby the TCR can negatively regulate signals generated through G protein-coupled receptors. PMID: 17420248
  18. FcgammaRIIB, a low-affinity immunoglobulin G Fc receptor, and CD3 are involved in cerebellar functions. PMID: 17502348
  19. CD3epsilon-mediated signal transduction pathway is essential for this transformation process PMID: 17507663
  20. mouse CD3 epsilon chains N-terminal charged residues have roles in generating isoforms modulating antigen T cell receptor-mediated signals and T cell receptor-CD3 interactions PMID: 17561508
  21. CD3epsilon proline-rich sequence amplifies weak TCR signals by promoting synapse formation and CD3epsilon phosphorylation PMID: 18566390
  22. have identified distinct roles for individual motifs of CD3epsilon in the preTCR-mediated differentiation and proliferation PMID: 19342663
  23. functional role for the CD3 epsilon lipid-binding domain in T cell biology PMID: 19542373
  24. importance of the conformational change in CD3epsilon for the activation of T cells PMID: 19671929

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*