Recombinant Mouse Thy-1 membrane glycoprotein(Thy1)

Code CSB-EP023525MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P01831
Relevance May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Thy-1 antigen CD_antigen: CD90
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
Research Area Immunology
Source E.coli
Gene Names Thy1
Protein Names Recommended name: Thy-1 membrane glycoprotein Alternative name(s): Thy-1 antigen CD_antigen= CD90
Expression Region 20-131aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 28.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Database Links

KEGG: mmu:21838

STRING: 10090.ENSMUSP00000110489

UniGene: Mm.3951

Pathway Leukocyte transendothelial migration

Related Products

Thy1 Antibodies

Thy1 Antibodies for Mus musculus (Mouse)

Thy1 Proteins

Thy1 Proteins for Mus musculus (Mouse)

Thy1 ELISA Kit

Thy1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.