Recombinant Mouse Thy-1 membrane glycoprotein (Thy1)

In Stock Promotion
Code CSB-EP023525MO
Abbreviation Recombinant Mouse Thy1 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Thy1; Thy-1; Thy-1 membrane glycoprotein; Thy-1 antigen; CD antigen CD90
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
20-131aa
Target Protein Sequence
QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in cell-cell or cell-ligand interactions during synaptogenesis and other events in the brain.
Gene References into Functions
  1. Molecular characterization of Thy1 expressing fear-inhibiting neurons within the basolateral amygdala identify and validate Ntsr2-expressing neurons as a putative 'Fear-Off' population. PMID: 27767183
  2. Results indicate that the close interaction between Thy-1 and Fas in lipid rafts regulates fibroblast apoptosis, and decreased fibroblast apoptosis associated with myofibroblast accumulation in mice lacking Thy-1. PMID: 28165468
  3. Thy-1 in CECs regulates VEGF-induced CEC activation and migration and links extracellular 7-KC to intracellular signaling. PMID: 27768790
  4. lincRNA-p21 overexpression dramatically inhibited acetylation of H3 and H4 at the Thy-1 promoter and Thy-1 expression levels in HLF1 cells. Finally, lincRNA-p21 interference rescued LPS-induced increase of lung and BAL collagen contents. LincRNA-p21 could lead to pulmonary fibrosis in ARDS by inhibition of the expression of Thy-1. PMID: 27392907
  5. The changes in CD90 and CD105 expression in the testis and ovary of mice are reported. PMID: 26679159
  6. Suggest that TGF-beta1 epigenetically regulates lung fibroblast phenotype through methylation of the Thy-1 promoter. PMID: 26333597
  7. Thy-1 facilitates the recruitment of membrane raft-residing signaling molecules such as Fyn kinase and the SFK regulator, Csk binding protein (Cbp), to focal adhesions via its direct coupling of integrins and raft domains. PMID: 26459603
  8. Thy-1 has an important role in controlling cell proliferation and cell differentiation in dermal fibroblasts. PMID: 25739049
  9. TLR4 activation enhances the PD-L1-mediated tolerogenic capacity of colonic CD90+ stromal cells. PMID: 25070848
  10. results indicate that CD90/Thy-1 is expressed on lymphatic endothelial cells and represents a suitable marker for murine lung lymph vessels PMID: 23408960
  11. Thy1-expressing subpopulation of basolateral amygdala pyramidal neurons provide an important molecular and pharmacological target for inhibiting fear PMID: 23785152
  12. These data suggest that blocking Thy-1 at wound areas using siRNA reduces repair and affects the re-epithelialization and over-expression of TGF-beta1 of the wound during the skin healing process. PMID: 23312577
  13. Thy-1 promoter becomes methylated in hypoxic fibroblasts resulting in reduced gene expression and activation of myofibroblast phenotype. PMID: 22938014
  14. Astrocytic alphaVbeta3 integrin inhibits neurite outgrowth and promotes retraction of neuronal processes by clustering Thy-1 PMID: 22479590
  15. Thy-1 promoted lipofibroblast differentiation via the expression of PPARgamma, stimulated lipid accumulation via fatty-acid esterification, and enhanced the fatty-acid uptake mediated by fatty-acid transporter proteins PMID: 22268140
  16. data suggest THY1 plays a role in cell adhesion via binding to integrin beta3 in ovaries; THY1 may be involved in cell-cell adhesion during formation of theca cell layer; induced of THY1 in ovaries may be affected by follicle stimulating hormone PMID: 21228213
  17. During acute lung inflammation, the extravasation of eosinophils and monocytes into the lung was significantly reduced in Thy-1-deficient mice. PMID: 21264853
  18. The machinery of NE/cAMP modulation of Thy-1 mRNA decay involves a cAMP responsive ARE in its 3' UTR and multiple site specific ARE binding proteins. PMID: 20412850
  19. Thy1 is a novel lymphatic vessel expressed gene, and has a potential role in the cell adhesion processes required for tumor progression and inflammation PMID: 20599951
  20. Findings suggest that Thy-1 down-regulates TNF-alpha-activated gene expression via interfering with SFK- and NF-kappaB-mediated transactivation. PMID: 20657842
  21. Thy-1-integrin alpha(v)beta(5) interactions inhibit contraction-induced latent TGF-beta1 activation, presumably by blocking the binding of extracellular matrix-bound latent TGF-beta1 with integrin alpha(v)beta(5). PMID: 20463011
  22. visual signals derived from the rat ChR2-expressing retinal ganglion cells under the control of a mouse Thy-1.2 promotor are reinterpreted by the brain to form behavior-related vision PMID: 19893752
  23. CBP plays a role in transiently anchoring Thy-1 to the cytoskeleton. PMID: 19825940
  24. Thy-1 triggering can partially substitute for signal 1 for T cell activation which, in combination with a strong signal 2, leads to robust T cell proliferation and IL-2 synthesis but does not induce cytolytic function. PMID: 12816984
  25. results indicate that alphaX-beta2 specifically interacts with Thy-1 PMID: 15850796
  26. Thy-1 signalling promotes the in vitro generation of CTL that kill in a granule-dependent fashion PMID: 16033530
  27. Loss of fibroblast Thy-1 expression correlates with lung fibrogenesis PMID: 16049324
  28. CD44(+) CD90(+) cells have the ability to generate neurospheres and to form vascular tubes PMID: 16962069
  29. Thy-1 positive cells have 4-8 times higher potential to show neuron-like morphology and differentiation than Thy-1 negative cells. PMID: 17006052
  30. Thus, CD90(+) cells are a newly identified additional cell fraction that increased during skeletal muscle regeneration in vivo and could be another cell source for therapy for lama2-deficient muscular dystrophy. PMID: 17963748
  31. Epigenetic regulation of Thy-1 is a novel and potentially reversible mechanism in fibrosis that may offer the possibility of new therapeutic options PMID: 18556592
  32. loss of Thy1 can influence the dopaminergic profile in the striatum PMID: 18615641
  33. Thy1 in myofibroblasts is not just a marker, but is a functional protein that transmits signals into the cell, up-regulating its FasL expression. PMID: 18676775
  34. Hypoxia, by reducing Thy-1, increases TGF-beta activation, and thereby inhibits normal alveolar development. PMID: 19270178

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*