Recombinant Mouse Toll-like receptor 7 (Tlr7), partial

In Stock
Code CSB-MP023606MO
Abbreviation Recombinant Mouse Tlr7 protein, partial
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Tlr7; Toll-like receptor 7
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
27-348aa
Target Protein Sequence
FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endosomal receptor that plays a key role in innate and adaptive immunity. Controls host immune response against pathogens through recognition of uridine-containing single strand RNAs (ssRNAs) of viral origin or guanosine analogs. Upon binding to agonists, undergoes dimerization that brings TIR domains from the two molecules into direct contact, leading to the recruitment of TIR-containing downstream adapter MYD88 through homotypic interaction. In turn, the Myddosome signaling complex is formed involving IRAK4, IRAK1, TRAF6, TRAF3 leading to activation of downstream transcription factors NF-kappa-B and IRF7 to induce proinflammatory cytokines and interferons, respectively.
Gene References into Functions
  1. Results suggest that toll-like receptor 7 (TLR7) needs to move to the cell periphery to induce robust type I interferon responses in plasmacytoid dendritic cells (pDC). PMID: 29150602
  2. The results demonstrate that TLR7 activation may trigger innate immunity pathways and induce apoptosis and hypoplasia of neonatal biliary trees in Balb/c mice. The novel findings give an implication of pathogenesis of infantile cholestasis, such as biliary atresia. PMID: 27590984
  3. TLR7 deletion reduces atherosclerosis in apolipoprotein E-deficient mice. PMID: 28405010
  4. SZU-101 enhances tumor clearance in vivo, without affecting the TLR7-NF-kappaB pathway activated by the TLR7 agonist in mouse spleen lymphocytes and bone marrow dendritic cells PMID: 28000738
  5. Up-regulation of TLR7 could eliminate intracellular Mtb through autophagy PMID: 28419514
  6. conclude that VDD promotes tumor growth in the context of Smad3 disruption, potentially through regulation of TLR7 expression and beta-catenin activation PMID: 27456065
  7. activation of TLR7 in the mouse bladder induced cystitis with sensory hyperactivity of the bladder PMID: 28595240
  8. Here, we show that under these circumstances, the Toll-like receptor (TLR)-7/8 ligand imiquimod, but not the TLR3 ligand poly I:C or TLR9 ligand CpG, mediated an effective antitumor response. The rejection of these immune-escaped cancers was mediated by NK cells and CD4(+) T cells, whereas activated CD8(+) T cells were dispensable PMID: 28637878
  9. TLR7 prevents progression of non-alcoholic fatty liver disease via induced autophagy and released IGF-1 from liver. These findings suggest a new therapeutic strategy for the treatment of NAFLD. PMID: 27279075
  10. Toll-like receptor 2 (TLR2) controls random motility, while Toll-like receptor 7 (TLR7) regulates chemotaxis of microglial cells via distinct pathways. Furthermore, TLR7 mRNA expression is down-regulated by TLR2 and TLR7 activation. PMID: 27554518
  11. results provide evidence that G, dG, 8-OHG and 8-OHdG are novel endogenous ligands for TLR7. PMID: 26489884
  12. Virus infection activates endosomal NOX2 oxidase and restricts TLR7 signaling, and that an endosomal NOX2 inhibitor decreases viral pathogenicity. PMID: 28701733
  13. TLR7 deficiency attenuates retinal damage in diabetic retinopathy model. PMID: 28843858
  14. The data demonstrate that an atypical TLR7 signaling pathway contributes to type interferon-beta expression during Y. pestis infection and suggest that the TLR7-driven type I IFN response plays an important role in determining the outcome of plague. PMID: 28847850
  15. Evaluation of the adjuvant effect of agonists of toll-like receptor 4 and 7/8 in a vaccine against leishmaniasis PMID: 28963929
  16. these data demonstrate that extracellular-miRNA mimics (miR-34a, -122, -133a, -142, -146a, and -208a) are potent innate immune activators and that the miRNAs most likely induce cytokine production and leukocyte migration through TLR7 signaling PMID: 28768728
  17. study demonstrates that activation of TLR7 signaling in T cells can inhibit Th17 cell differentiation from naive T cells and IL-17 production in established Th17 cells; further report that downregulation of STAT3 signaling is responsible for TLR7-mediated inhibition of Th17 cells due to induction of suppressor of cytokine signaling 3 and 5 PMID: 28652396
  18. identification of a novel mechanism by which TLR and type I IFN synergize to promote monocyte/macrophage development from hematopoietic progenitors, a process critical in triggering rapid immune responses during infection PMID: 27566824
  19. Notch1-Hes-1 signaling controls TLR7-induced autophagic death of macrophage via regulation of P62 in mice with lupus. PMID: 27537524
  20. Dual TLR2/TLR7 agonist induced the maturation of dendritic cells and primed substantial populations of cytolytic and highly polyfunctional effector CD8(+) T cells in vitro, and safely potentiated the immunogenic properties of a nanoparticulate Ag in vivo, eliciting humoral responses with a balanced TH1/TH2 profile in mice. PMID: 28432147
  21. determine the effects of a loss of autophagy in dendritic cells (DCs), as well as both B cells and DCs, in a TLR7-mediated model of autoimmunity, similar to systemic lupus erythematosus, where both cell types are critical for disease PMID: 28031336
  22. findings show that TLR7 activation significantly promoted interphotoreceptor retinoid-binding protein (IRBP)-specific Th17 responses by upregulating RORgammat, IL-17, GM-CSF, and IL-23R expression in experimental autoimmune uveitis mice. PMID: 27798152
  23. CD72 appears to specifically inhibit B cell response to the endogenous TLR7 ligand Sm/RNP. PMID: 27810925
  24. TLR8 coupling with SOCS-1 inhibits TLR7-mediated antiviral immunity during WNV infection in mice. PMID: 27798161
  25. Azithromycin impairs imiquimod-induced dendritic cell activation by decreasing lysosomal acidification and disrupting TLR7 maturation and signaling. PMID: 27449383
  26. the activation of TLR7 increased CCND3 expression via the downregulation of miR-15b in B cells. PMID: 26144250
  27. this study demonstrates the critical role of Gfi1 in the regulation of myeloid cells, and prevention of spontaneous lupus autoimmunity by negatively controlling TLR7 signaling PMID: 27600904
  28. this study shows that beta,beta-dimethylacryloyl alkannin could inhibit psoriasis-activated dendritic cells via the TLR7/8 pathway PMID: 27697724
  29. Orally administered R848 triggers TLR-7 on CD11c(+) dendritic cells, inducing interleukin-23 (IL-23) expression followed by a burst of IL-22 secretion by innate lymphoid cells, leading to Reg3gamma expression and restoration of colonization resistance against vancomycin-resistant enterococcus. PMID: 26912904
  30. Aging Impairs the Ability of Conventional Dendritic Cells to Cross-Prime CD8+ T Cells upon Stimulation with a TLR7 Ligand. PMID: 26474053
  31. Type I Interferons maintain expression of TLR7 in B cells and conventional dendritic cells in different ways; total amount of TLR7 is kept in B cells and TLR7(+) population is retained among conventional dendritic cells. PMID: 26621862
  32. These data provide direct evidence that B cells require TLR7-dependent priming through an autophagy-dependent mechanism before autoimmunity is induced, thereafter involving many cell types. PMID: 26120731
  33. describe novel roles for type I IFN and TLR7 signaling in nonhematopoietic cells PMID: 26289159
  34. Data show that preconditioning with poly(I:C) alters toll-like receptors (TLR) and RIG-I-like receptors (RLRs) responses in opposite directions. PMID: 26392465
  35. Report chemical conjugation of TLR7 agonist T7 and multi-repeat-epitope of monoclonal gastric cancer 7 antigen exerts antitumor effects. PMID: 26185376
  36. Our data show that TLR7 excess influences the selection, expansion and diversification of B cells in the germinal center, independent of other genes in the Yaa locus. PMID: 25794167
  37. an important role of 2'-O-methylation for shaping differential TLR7 or TLR8 activation PMID: 25785446
  38. Cardiac RNA induces inflammatory responses in cardiomyocytes and immune cells via MyD88-TLR7 signaling. PMID: 26363072
  39. B-cell intrinsic TLR7 signals promote depletion of the marginal zone in a murine model of Wiskott-Aldrich syndrome. PMID: 26256668
  40. A mucolipin agonist specifically enhanced TLR7 responses to ssRNAs. PMID: 25239130
  41. These studies identify that TLR7 stimulation leads to the expansion of IL-10-producing CD19(+) CD1d(hi) B cells, which can suppress allergic lung inflammation via T regulatory cells. PMID: 25763771
  42. Treatment with Let7c and miR21 restricted dendritic growth of wild-type neurons but not Tlr7(-/-) neurons PMID: 25917529
  43. activation exacerbated lupus nephritis through dendritic and t-regulatory cells PMID: 25341693
  44. TLR8 deletion accelerated autoimmunity in lupus-prone mice in response to TLR7 activation. PMID: 25424423
  45. Inhibition of IDO could enhance the therapeutic efficacy of TLR7 agonists via the increase of T helper type 1 immune response in tumors. PMID: 25322876
  46. Study demonstrates for the first time that influenza A virus and TLR7 activation enhance the NOX2 oxidase-dependent oxidative burst in macrophages. PMID: 24869957
  47. This work identifies signalling through TLR7 as a source of pathology in experimental cerebral malaria. PMID: 25192715
  48. Results suggest that the TLR7 response following Japanese encephalitis virus infection promotes type-1 interferon production and generation of antiviral state which might contribute to protective effect in systemic infection PMID: 24909816
  49. A single copy of TLR7 in B cells is the minimal requirement for breaking the germinal center-tolerance checkpoint. PMID: 25252960
  50. TLR7 activation led to myd88-dependent production of pro-inflammatory cytokines in dystrophin-deficient muscle cells. PMID: 24368419

Show More

Hide All

Subcellular Location
Endosome membrane. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Lysosome. Cytoplasmic vesicle, phagosome. Note=Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist.
Protein Families
Toll-like receptor family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*