Recombinant Mouse Tumor necrosis factor ligand superfamily member 13B (Tnfsf13b), partial

Code CSB-MP894359MO
Abbreviation Recombinant Mouse Tnfsf13b protein, partial
MSDS
Size $102
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
B-cell-activating factor;BAFF
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
129-309aa
Target Protein Sequence
QGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.5 kDa
Protein Length
Partial
Tag Info
N-terminal mFc2a-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.; Isoform 2 seems to inhibit isoform 1 secretion and bioactivity.
Gene References into Functions
  1. BAFF loop region controls B cell survival and regulates recognition by different inhibitors PMID: 29572442
  2. Male mice lacking the androgen receptor have increased splenic B cell numbers, serum BAFF levels and splenic Baff mRNA. Testosterone deficiency by castration causes expansion of BAFF-producing fibroblastic reticular cells in spleen. PMID: 29802242
  3. results indicate that the BAFF-BAFFR ligation bridged between microglia and neurons could play a critical neuroprotective role in brain ischemic injuries PMID: 28918255
  4. Data presented show that B-cell activating factor (BAFF) plays a central role in the induction and maintenance of cigarette smoke-induced pulmonary antinuclear antibodies and suggest a therapeutic potential for BAFF blockade in limiting autoimmune processes associated with smoking. PMID: 28039405
  5. This study suggests that BAFF selects IL-10(-)B cells over IL-10(+) regulatory B cells via BAFF receptors in inflammatory responses PMID: 28199852
  6. BAFF plays a previously unappreciated role in lupus nephritis by inducing renal tertiary lymphoid structures and regulating the position of T cells within the glomeruli. PMID: 28235864
  7. this study shows that BAFF overexpression reduces hypercholesterolemia and atherosclerosis in hyperlipidemic mice via TACI-dependent B cell activation PMID: 27837104
  8. B cell-activating factor (BAFF) upregulates CD28/B7 and CD40/CD154 expression, and promotes the interactions between T and B cells in a BAFF receptor-dependent manner. PMID: 27180986
  9. findings highlight a novel mechanism through which BAFF promotes humoral autoimmunity via direct, TACI-dependent activation of transitional B cells PMID: 27022196
  10. neutrophils secreted a B cell-activating factor that highly accelerated plasma cell generation and antigen-specific antibody production. PMID: 27432941
  11. The enhanced thermogenic program was confirmed by higher protein levels of UCP1 and irisin in female BAFF-/- than in WT mice. PMID: 27814392
  12. Antibodies That Block or Activate Mouse B Cell Activating Factor of the Tumor Necrosis Factor (TNF) Family (BAFF), Respectively, Induce B Cell Depletion or B Cell Hyperplasia. PMID: 27451394
  13. Increased B-cell activating factor (BAFF) induced B cell differentiation into germinal center (GC) B cells within the autoimmune target tissue. PMID: 27352977
  14. The Tnfas13b in the hippocampus in the prefrontal cortex of the DBA/2 J strain were up-regulated. PMID: 25895500
  15. early Ab responses contribute to the optimal formation of B cell memory through IgG-immune complexes and BAFF. PMID: 26621863
  16. autoimmunity induced by excessive BAFF production requires B1b B cells and CD19 signaling. PMID: 26103922
  17. Data show that production of autoantibodies in B cell-activating factor of the TNF family (BAFF) is dependent on tumor necrosis factor receptor superfamily, member 13b protein (TACI) expression by B cells. PMID: 26027434
  18. Cigarette smoke may hinder early mucosal IgA responses in the lung during influenza virus infection through oxidative inhibition of BAFF, which might contribute to the increased incidence and severity of viral infections in smokers. PMID: 25849069
  19. Antagonizing BAFF in cigarette smoke-exposed mice attenuates pulmonary inflammation and alveolar destruction. PMID: 26266827
  20. the elevated presence of APRIL and BLyS in B cell-rich areas of chronically inflamed gingiva suggests that these cytokines may contribute to bone loss by promoting the survival and persistence of RANKL-expressing B cells/plasma cells. PMID: 26150532
  21. B cell activating factor (BAFF) and a proliferation inducing ligand (APRIL) mediate CD40-independent help by memory CD4 T cells in transplantations. PMID: 25496308
  22. BAFF knockout improves systemic inflammation via regulating adipose tissue distribution in high-fat diet-induced obesity. PMID: 25591987
  23. Our data therefore support a role for BAFF in the establishment of pulmonary fibrosis and a crosstalk between IL-1beta, BAFF and IL-17A. PMID: 25441030
  24. BAFF(anti-B-cell activating factor) blockade delayed antibody production and increased GAA activity within tissues with protection from anaphylaxis. Anti-BAFF also resolved antibody formation during an immune response. PMID: 25842186
  25. Immunization of mice with a DNA vaccine encoding BAFF or APRIL multitrimers, together with interleukin 12 and membrane-bound HIV-1 Env gp140, induced neutralizing antibodies against tier 1 and tier 2 (vaccine strain) viruses. PMID: 25631080
  26. This study offers a rationale for localized therapeutic BAFF inhibition in primary Sjogren's syndrome and represents a proof of concept of the interest of exon skipping in autoimmune diseases. PMID: 24304965
  27. Blockade of IL-21 decreases BAFF levels, which modulates T-cell and B-cell responses via mTORC inhibition. PMID: 25246268
  28. Nitric oxide produced by inflammatory monocytes and their derivative dendritic cell subsets plays an important role in regulating BAFF production and T cell-independent antibody responses. PMID: 24951820
  29. BAFF controls neural cell survival through BAFF receptor. PMID: 23923031
  30. IL-4 regulates Bim expression and promotes B cell maturation in synergy with BAFF conferring resistance to cell death at negative selection checkpoints. PMID: 24835393
  31. B cells chronically exposed to high levels of BAFF were poised for rapid induction of aerobic glycolysis and metabolic reprogramming. PMID: 24616478
  32. This study suggests that BAFF suppresses IL-15 expression in autoimmune diseases PMID: 24670802
  33. Local BLyS production by T follicular cells mediates retention of high affinity B cells during affinity maturation. PMID: 24367004
  34. Although we have found that TACI is dispensable for controlling B. hermsii infection, mice deficient in BAFFR or BAFF exhibit impairment in B. hermsii-specific IgM responses and clearance of bacteremia. PMID: 24218480
  35. Addition of BAFF to plasmablasts in vitro rescued IgM secretion, suggesting that BAFF signaling can directly regulate secretory processes. PMID: 24082070
  36. The ability of TACI-Fc to activate reverse signalling through BAFF and APRIL, was investigated. PMID: 23620746
  37. BAFF decreases leptin and adiponectin expression, but increases the expression of proinflammatory adipokines monocyte chemotactic protein-1, interleukin-6 (IL-6), cyclooxygenase-2 (COX-2) and haptoglobin. PMID: 23306702
  38. CD1d-restricted invariant NKT cell-derived BAFF and APRIL each contribute to survival of plasma cells induced by immunization. PMID: 23797666
  39. Blockade of B-cell-activating factor signaling enhances hepatic steatosis induced by a high-fat diet and improves insulin sensitivity. PMID: 23318884
  40. BAFF-overexpressing mice were protected from lethal malaria infections, indicating the significance of the role BAFF plays in determining the outcome of malaria infections. PMID: 22936176
  41. Bcl10 controls BAFF-induced canonical NF-kB activation directly and noncanonical NF-kB activation indirectly determining the survival of anergic B cells. PMID: 23087406
  42. Studies identify p202 as a regulator of murine BAFF. PMID: 22784990
  43. BAFF-specific inhibitor AMG623 peptibody reduces B-cell number and improves outcomes in murine models of autoimmune disease. PMID: 22325420
  44. Elimination of both APRIL and BAFF had no discernible effect on the development of renal immunopathology or clinical disease beyond that of elimination of BAFF alone. PMID: 22127792
  45. Serum BAFF levels are elevated in RP105-deficient mice, and partial BAFF neutralization rescues aberrant B cell proliferative responses in such mice. PMID: 22291190
  46. In vivo BLyS neutralization effectively induces humoral tolerance and promotes long-term islet allograft survival in mice. PMID: 22262127
  47. BAFF-R expression is tightly regulated during B-cell development in mouse and human and this expression is correlated with positive selection. PMID: 22028296
  48. Soluble BAFF levels inversely correlate with peripheral B cell numbers and the expression of BAFF receptors. PMID: 22124120
  49. adipogenic differentiation may alter the immunoregulatory property of MSCs, leading to stimulation of lymphocytes response. The BAFF molecule secreted by the adi-MSCs was responsible for this event. PMID: 21902897
  50. a contribution of BAFF to pathogenic Th17 cell responses PMID: 21897850

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 13b, soluble form]: Secreted.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Isoform 2 is expressed in many myeloid cell lines.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*