Recombinant Mouse Tumor necrosis factor ligand superfamily member 4 (Tnfsf4), partial

In Stock
Code CSB-MP023994MO1
Abbreviation Recombinant Mouse Tnfsf4 protein, partial
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
OX40 ligand
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
49-198aa
Target Protein Sequence
QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.9 kDa
Protein Length
Partial
Tag Info
N-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Gene References into Functions
  1. these findings demonstrate the utility of soluble OX40 L and JAG1 to induce TCR-independent regulatory T-cells proliferation PMID: 28045060
  2. The OX40L expression is induced on the bronchiolar progenitors for the antiviral immunity during the infectious process. However, these defense-like host responses lead to more extensive infection with the influenza virus owing to the induced OX40L with alpha-2,6 sialic acid modification, which augments the interaction with the viral hemagglutinin. PMID: 26976612
  3. Rhinovirus infection interferes with induction of tolerance to aeroantigens through OX40 ligand, thymic stromal lymphopoietin, and IL-33 PMID: 26100084
  4. intestinal Th2 priming is initiated by an autocrine/paracrine acting CD4(+) Th cell-intrinsic IL-4 program that is controlled by DC OX40L, and not by NKT, gammadelta T, or ILC cells. PMID: 24781052
  5. a critical role of OX40L presented by the activated basophils to initiate Th2 responses in an allergic asthma model, implicating OX40-OX40L signaling as a potential therapeutic target in the treatment of allergic airway inflammation. PMID: 25839234
  6. The majority of transferred CD40L(-/-) T cells in Rag-1(-/-) B6 mice were differentiated to CD44(high). PMID: 24254032
  7. The need for additional immune suppression in the intestine reflects commensal microbe-driven T-cell activation through the accessory costimulation molecules ICOSL and OX40L in B7 deprived mice. PMID: 25002484
  8. we identify a previously unknown role for OX40L in steady-state bone homeostasis PMID: 24469824
  9. Data indicate that OX40L contributes to both the development of Th2 cells and secondary Th2 responses induced by KLH-pulsed CD8- cDCs in vivo. PMID: 24462862
  10. These results showed a critical role for OX40L- and Jagged1-induced cosignaling in GM-BMDC-induced Treg expansion. PMID: 23630352
  11. engagement of OX40L selectively suppresses Fyn-initiated signals required for MC degranulation and serves to limit immediate hypersensitivity PMID: 22564682
  12. Present findings suggest a role for the OX40L-derived immune response and epistatic genetic effect in immune-mediated pathogenesis of PAH. PMID: 22171643
  13. The vascular OX40/OX40L system plays an important role in the formation of vasa vasorum and subsequent atherosclerosis. PMID: 20584752
  14. our data provide an in vivo role for the OX40/OX40L system in the innate immune response during polymicrobial sepsis PMID: 20844189
  15. Tumor necrosis factor ligand OX40L-expressing Langerhans cells play a mandatory role in the induction of regulatory T cells in ultraviolet B immunosuppressed mice. PMID: 20400709
  16. Constitutive interaction of OX40 ligand with OX40 during immune regulation is linked to the development of autoimmune-like diseases in OX40L-transgenic mice. PMID: 12370402
  17. Costimulation via OX40L expressed by B cells is sufficient to determine the extent of primary CD4 cell expansion and Th2 cytokine secretion. PMID: 12668647
  18. Critical role for OX40 ligand in the development of pathogenic Th2 cells in a murine model of asthma. PMID: 12672051
  19. Engagement of OX40 by an OX40L:Ig fusion protein drives IFN-gamma production by CD4+ T cells and reduces eosinophilia and the burden of Cryptococcus neoformans in the lung. PMID: 12794142
  20. A null allele at OX40L completely prevents diabetes development in nonobese diabetic mice and strongly reduces its incidence in a T cell receptor transgenic model, while paradoxically sustaining the long-term progression to autoimmune destruction. PMID: 14662903
  21. OX40-OX40L interaction affects both regulatory and nonregulatory T cells by influencing suppression, susceptibility to suppression, and clonal expansion. PMID: 15004159
  22. OX40 and OX40L interactions form a late checkpoint in diabetes development and are realistic targets for therapeutic intervention. PMID: 15368274
  23. neonatal CD4+ CD3- cells up-regulate both CD30L and OX40L after adoptive transfer into an adult recipient PMID: 16920944
  24. OX40 ligand (OX40L) is required for optimal T helper (Th) type 2 cell priming and memory Th2 responses in vivo; dependence upon OX40L is predominantly due to the provision of signaling through OX40 rather than retrograde signaling dendritic cells. PMID: 17785785
  25. These results show a critical role for OX40L on DCs, via binding to OX40 on NKT cells and CD4+ T cells, in the induction of antitumor immunity in tumor-bearing mice. PMID: 17975668
  26. OX40 ligand (OX40L) is a critical in vivo mediator of TSLP-mediated Th2 responses. PMID: 18060034
  27. Th2 skewing is mediated by OX40L PMID: 18354165
  28. TNFSF4 gene is identified as a potential candidate Sjogren's syndrome susceptibility gene. PMID: 19032782
  29. OX40L may play an important role in the early phase of T cell activation and proliferation PMID: 19663699

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*