Recombinant Mouse Tumor necrosis factor receptor superfamily member 3 (Ltbr), Partial (Active)

In Stock
Code CSB-MP013227MO
Abbreviation Recombinant Mouse Ltbr protein, partial (Active)
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Mouse Ltbr at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 15.43-18.78 ng/ml. Biological Activity Assay
  • The purity of Ltbr was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Ltbr at 2 μg/ml can bind human TNFSF14 (CSB-MP023991HUj7-B), the EC50 is 15.43-18.78 ng/ml.
Target Names
Uniprot No.
Alternative Names
Lymphotoxin-beta receptor
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
31-223aa
Target Protein Sequence
QLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLL
Mol. Weight
23.1kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Lymphotoxin-beta receptor orchestrates lymphoid organogenesis and immune homeostasis through its interactions with membrane-bound lymphotoxin heterotrimers and LIGHT, making precise characterization of these binding events essential for understanding secondary lymphoid tissue development and inflammatory signaling. This recombinant extracellular domain (aa 31–223) demonstrates quantifiable binding to human TNFSF14 with an EC50 of 15.43–18.78 ng/ml in functional ELISA, providing a validated reagent for ligand-binding assays, competitive inhibition studies, and blocking antibody screening campaigns targeting the LTβR–LIGHT axis. Mammalian expression preserves the native glycosylation and disulfide architecture critical for conformational integrity in receptor-ligand interaction studies, including surface plasmon resonance and biolayer interferometry experiments that demand physiologically relevant binding kinetics. The protein meets quality thresholds commonly required for therapeutic antibody epitope mapping and small-molecule inhibitor screening, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg to support cell-based functional assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs.
Gene References into Functions
  1. These findings demonstrate the importance of LTbetaR signaling in leukocyte migration. PMID: 30069025
  2. our study clarifies the epithelial intrinsic role of LTbR on medullary thymic epithelial cells development and function; more importantly, it reveals a previously unrecognized function of LTbR on the control of the size of medullary thymic epithelial cells progenitor population. PMID: 28290551
  3. LTbetaR is required for T-cell regeneration on irradiation-induced thymic injury. PMID: 27493002
  4. Regulatory T-lymphocytes engage lymphotoxin beta receptor for afferent lymphatic transendothelial migration to preserve the survival of a pancreatic islet graft. PMID: 27323847
  5. Low LTBR expression is associated with Herpes Simplex. PMID: 29743364
  6. The LIGHT (Tumour necrosis factor ligand superfamily member 14, TNFSF14)/Lymphotoxin beta-Receptor(LTbeta-R) pathway, which is involved in T-cell and macrophage activation, was diminished in plasma and in apoE-/-Irs2+/-HL-/- atheromas. PMID: 27172975
  7. Data indicate that thymus medulla specialization for thymic tolerance segregates from medulla organogenesis and instead involves lymphotoxin beta receptor (LTbetaR)-mediated regulation of the thymic dendritic cells (DCs) pool. PMID: 28830910
  8. EAE induced by weak activation of innate immunity requires the NLRP3 inflammasome and is sensitive to interferon-beta treatment PMID: 27820602
  9. Data show that growth of regenerating splenic tissue is suppressed by lymphotoxin beta-receptor (LTbetaR) expression at non-splenic sites. PMID: 27936003
  10. LTbetaR is essential for efficient liver regeneration and cooperates with TNFRp55 in this process. Differences in survival kinetics strongly suggest distinct functions for these two cytokine receptors in liver regeneration. PMID: 26708145
  11. our results reveal a novel role for LTbetaR signaling in epithelial cells in the regulation of intestinal epithelial cell homeostasis to limit mucosal damage. PMID: 25183367
  12. expression on artery tertiary lymphoid organs protects against atherosclerosis in aged mice PMID: 26084025
  13. DC-derived LTBR ligands are critical mediators of lymph node cells survival, and LTBR signaling on reticular stromal cells is mediated by Pdpn expression. PMID: 25902483
  14. LTbR plays a role in macrophage-driven inflammation in atherosclerotic lesions from ApoE knockout mice, probably by augmenting the Ccl5-mediated recruitment of monocytes. PMID: 25740843
  15. M1 macrophages as inducer cells that trigger the expression of chemokines by vascular smooth muscle cell independently of lymphotoxin beta receptor signalling PMID: 24272771
  16. lymphotoxin beta receptor regulates the development of the CCL21-expressing subset rather than the Aire-expressing subset of postnatal Medullary thymic epithelial cells. PMID: 23585674
  17. found that conditionally LTbetaR-deficient animals failed to develop a significant proportion of their peripheral lymph nodes PMID: 23420877
  18. LTbetaR activation on mouse macrophages is involved in the control of pro-inflammatory cytokine and mediator expression by activation of a signalling pathway that controls exacerbating inflammatory cytokine production. PMID: 23220069
  19. LTbetaR activation on macrophages controls the pro-inflammatory response by activation of a TRIM30alpha-dependent signaling pathway PMID: 22437076
  20. LTbetaR activation on macrophages by T cell-derived lymphotoxin alpha(1)beta(2) controls proinflammatory responses by activation of a TRIM30alpha-controlled, counterregulatory signaling pathway to protect against exacerbating inflammatory reactions. PMID: 22357629
  21. Lymphotoxin-beta-receptor (LTbetaR) signaling, a pathway essential for lymphoid organogenesis, abrogates tertiary lymphoid organ development in heart transplantationl PMID: 21926237
  22. LTbetaR signaling in gut lymphoid follicles regulates IL-22 production by innate lymphoid cells in response to mucosal pathogen challenge. PMID: 21767811
  23. expression of tumor necrosis factor superfamily member 14 and lymphotoxin-beta receptor by motoneurons in vivo correlates with the preferential expression of interferon-gamma at disease onset and symptomatic stage in amyotrophic lateral sclerosis mice PMID: 21072055
  24. the LTbetaR signal exhibits a novel and unique function in promoting RANK activity for medullary thymic epithelial cell organization PMID: 21441458
  25. LTBR-pathway in Sjogren's syndrome: CXCL13 levels and B-cell-enriched ectopic lymphoid aggregates in NOD mouse lacrimal glands are dependent on LTBR. PMID: 21153342
  26. Following infection of LTbetaR(-/-) mice with the Gram-negative pathogen Citrobacter rodentium, IL-22 production from NCR22 cells was not affected. PMID: 21341264
  27. Lymphotoxin-beta receptor activation by lymphotoxin-alpha(1)beta(2) and LIGHT promotes tumor growth in an NFkappaB-dependent manner. PMID: 20473944
  28. show that a cognate interaction between LTalphabeta on CD4(+) helper T cells and LTbeta receptor on DCs results in unique signals that are necessary for optimal CD8(+) T-cell expansion via a type I IFN-dependent mechanism PMID: 21245292
  29. During ontogeny, only the LTbetaR pathway is crucial for development of the splenic marginal zone and the compartments of the white pulp (T, B, and mixed T/B cell zones). PMID: 21187446
  30. the LTbetaR modifies the ubiquitin:NIK E3 ligase, and also acts as an allosteric regulator of the ubiquitin:TRAF E3 ligase PMID: 20348096
  31. demonstrate that the LTbetaR signaling was required for the regulation of the early innate response against infection. PMID: 20226692
  32. Mouse aorta smooth muscle cells differentiate into lymphoid tissue organizer-like cells on combined tumor necrosis factor receptor-1/lymphotoxin beta-receptor NF-kappaB signaling. PMID: 20139367
  33. LT beta receptor and its interaction with LT alpha are required for the presence of B lymphocytes in the intestinal lamina propria. PMID: 11994450
  34. Embryonic LTbetaR is expressed from E16.5 onward in respiratory, salivary, bronchial and gastric epithelium, which may be consistent with early communication events between lymphoid elements and epithelial specialization in emerging mucosal lymph nodes. PMID: 11994460
  35. ligation of this receptor induces the processing of the cytosolic NF-kappaB2/p100 precursor to yield the mature p52 subunit, followed by translocation of p52 to the nucleus PMID: 12387745
  36. LTbetaR-induced activation of p100 processing is critically involved in the function of stromal cells during the generation of secondary lymphoid organ microarchitectures. PMID: 12556537
  37. comparison of signal pathways leading to NF-kB induction in response to TNFa and LTbR activation indicates LTbR-induced binding of RelB/p50 requires processing of p100 that is mediated by IKKalpha but is independent of IKKbeta, NEMO/IKKgamma, and RelA. PMID: 12709443
  38. Signaling of lymphotoxin (LT)alpha1beta2 heterotrimers via the LT beta receptor is an essential prerequisite for containment of intracellular pathogens Mycobacterium tuberculosis and Listeria monocytogenes. PMID: 12734369
  39. Immature isolated lymphoid follicles (ILFs) are inducible structures in the small intestine requiring LT beta-R for their formation. PMID: 12759424
  40. membrane lymphotoxin beta receptor is important in resistance to Theiler's virus infection PMID: 12882833
  41. Retention of mature T cells is associated with autoimmune phenomena, suggesting an unexpected role for LTbetaR signaling in central tolerance induction. PMID: 12953095
  42. role of activation in lymphoid organogenesis and tumor development PMID: 12957791
  43. Treatment with an LT beta receptor-Fc Ig fusion protein markedly inhibits the development of cutaneous graft-versus-host disease and weight loss, possibly by inhibiting the expression of adhesion molecules. PMID: 14734744
  44. In graft arterial disease, LTbetaR was expressed in smooth muscle cells (SMCs) with or without cytokine stimulation. The LIGHT pathway plays important roles in the regulation not only of T-cell activation but also of SMC proliferation. PMID: 15178556
  45. LTbetaR expressed on mast cells can transduce a costimulatory signal in T cell-dependent mast cell activation. PMID: 15187124
  46. Lymphotoxin-beta receptor interactions are critical for immunity against Citrobacter rodentium in mice. PMID: 15521015
  47. Pregnant NOD mice treated with LTbr immunoglobulin fusion protein protected offspring from diabetes. PMID: 15561941
  48. Lymphotoxin beta receptor- and lymphotoxin alpha-dependent interactions are required to initiate postnatal development of small intestinal lymphoid aggregates. PMID: 15585839
  49. double positive thymocytes regulate the differentiation of early thymocyte progenitors and gammadelta cells by a mechanism dependent on the transcription factor RORgt, and the lymphotoxin (LT) beta receptor (LTbetaR) PMID: 15591166
  50. isolated lymphoid follicles (ILF) formation in the large intestine is accelerated by blockage of LTbetaR and TNFR55 signals in utero, and ILF, like colonic patches, might play a role in the induction of IgA response in the large intestine PMID: 15778401

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*