Recombinant Mannheimia haemolytica Leukotoxin (lktA), partial

Code CSB-YP314743ESE
Abbreviation Recombinant Mannheimia haemolytica lktA protein, partial
MSDS
Size US$436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
lktA
Uniprot No.
Research Area
Others
Alternative Names
lktA; Leukotoxin; Lkt
Species
Mannheimia haemolytica (Pasteurella haemolytica)
Source
Yeast
Expression Region
715-953aa
Target Protein Sequence
IGTSHNDIFKGSKFNDAFNGGDGVDTIDGNDGNDRLFGGKGDDIIDGGNGDDFIDGGKGNDLLHGGKGDDIFVHRQGDGNDSITESEGNDKLSFSDSNLKDLTFEKVNHHLVITNTKQEKVTIQNWFREAEFAKTIQNYVATRDDKIEEIIGQNGERITSKQVDELIEKGNGKIAQSELTKVVDNYQLLKYSRDASNSLDKLISSASAFTSSNDSRNVLASPTSMLDPSLSSIQFARAA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The N-terminal 6xHis tag was fused to the gene fragment corresponding to the 715-953aa of the Mannheimia haemolytica lktA protein and then was cloned into an expression vector. The expression vector was transfected into the yeast cells for expression. The generated product was purified and separated to obtain the recombinant Mannheimia haemolytica lktA protein. Its purity is higher than 90%. This recombinant lktA protein showed an apparent molecular weight of about 30 kDa under SDS-PAGE condition.

The specified functions of lktA protein in diseases is not well understood. Some studies suggested that lktA production by Fusobacterium necrophorum strains in relation to severity of liver abscesses in cattle. Several researches suggested that lktA is related to the tumors. For example, it has been identified that lktA induces ATP expulsion through pannexin-1 channels and subsequent cell death in malignant lymphocytes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Pasteurella leukotoxins are exotoxins that attack host leukocytes and especially polymorphonuclear cells, by causing cell rupture. The leukotoxin binds to the host LFA-1 integrin and induces a signaling cascade leading to many biological effects, including tyrosine phosphorylation of the CD18 tail, elevation of the intracellular Ca(2+) and lysis of the host cell. This leukotoxin is a major contributor to the pathogenesis of lung injury in ovine pneumonic pasteurellosis. It has also weak hemolytic activity.
Subcellular Location
Secreted. Host cell membrane; Multi-pass membrane protein.
Protein Families
RTX prokaryotic toxin (TC 1.C.11) family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*