Recombinant Pig E-selectin(SELE),partial

Code CSB-EP020975PI
Product Type Recombinant Protein
Size US$2466
Uniprot No. P98110
Relevance Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ;ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ;LECAM2;; CD62E
Species Sus scrofa (Pig)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence WSYSASTETMTFDDASAYCQQRYTHLVAIQNHAEIEYLNSTFNYSASYYWIGIRKINGTWTWIGTKKALTPEATNWAPGEPNNKQSNEDCVEIYIKRDKDSGKWNDERCSKKKLALCYTAACTPTSCSGHGECIETINSSTCQCYPGFRGLQCEQVVECDALENPVNGVVTCPQSLPWNTTCAFECKEGFELIGPEHLQCTSSGSWDGKKPTCKAVTCDTVGHPQNGDVSCNHSSIGEFAYKSTCHFTCAEGFGLQGPAQIECTAQGQWTQQAPVCKAVKCPAVSQPKNGLVKFTHSPTGEFTYKSSCAFSCEEGFELRGSAQLACTSQGQWTQEVPSCQVVQCSSLEVPREINMSCSGEPVFGAVCTFACPEGWMLNGSVALTCGATGHWSGMLPTCEAPAESKIP
Research Area Others
Source E.coli
Gene Names SELE
Expression Region 23-429aa
Tag Info N-terminal GST-tagged
Mol. Weight 71.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell-surface glycoprotein having a role in immunoadhesion
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Selectin/LECAM family
Database Links

KEGG: ssc:397508

STRING: 9823.ENSSSCP00000006699

UniGene: Ssc.16297

Pathway TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications

Related Products

SELE Antibodies

SELE Antibodies for Pig

SELE Proteins

SELE Proteins for Sus scrofa (Pig)

SELE ELISA Kit

SELE ELISA Kit for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.