Recombinant Pig Growth hormone receptor (GHR), partial

In Stock
Code CSB-EP009411PI
Abbreviation Recombinant Pig GHR protein, partial
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
GHR; Growth hormone receptor; GH receptor; Somatotropin receptor
Species
Sus scrofa (Pig)
Source
E.coli
Expression Region
19-264aa
Target Protein Sequence
FSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Pig Growth Hormone Receptor (GHR) is expressed in E. coli and contains amino acids 19 to 264 of the full-length protein, representing a partial sequence. This protein comes engineered with a C-terminal 6xHis-tag, which helps streamline purification and detection processes. Its purity appears to exceed 85% as confirmed by SDS-PAGE analysis, suggesting it's suitable for various research applications. The product is intended for research use only and not for diagnostic or therapeutic purposes.

The Growth Hormone Receptor (GHR) plays a critical role in regulating growth and metabolism. It participates in the growth hormone signaling pathway, mediating growth hormone effects by binding to it and triggering downstream signaling cascades. This receptor seems essential for various physiological processes, making it an important target for studies on growth disorders and metabolic research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies

This recombinant pig GHR extracellular domain (19-264aa) can help investigate binding interactions with growth hormone and other potential ligands through surface plasmon resonance, bio-layer interferometry, or pull-down assays. The C-terminal 6xHis tag makes immobilization on nickel-coated surfaces or beads more straightforward for interaction studies. Researchers may determine binding kinetics, affinity constants, and specificity of various ligands to the pig GHR extracellular region. This application appears particularly valuable for comparative studies between pig and other mammalian growth hormone receptors.

2. Antibody Development and Characterization

The purified recombinant pig GHR protein works well as an immunogen for generating species-specific antibodies against pig growth hormone receptor. Researchers can use the protein in ELISA-based screening of hybridoma clones or phage display libraries to identify high-affinity antibodies. The 6xHis tag also allows for easier purification and immobilization for antibody validation assays, epitope mapping studies, and determination of antibody specificity and cross-reactivity patterns.

3. Structural and Biochemical Analysis

This recombinant protein provides material for biophysical characterization studies including circular dichroism spectroscopy, dynamic light scattering, and analytical ultracentrifugation to assess protein folding, stability, and oligomerization state. The extracellular domain fragment can be analyzed for post-translational modifications, thermal stability, and conformational changes under various buffer conditions. These studies may contribute to understanding the structural properties of pig GHR compared to other species.

4. In Vitro Competitive Binding Assays

The recombinant pig GHR can be used in competitive binding assays to screen potential growth hormone analogs, antagonists, or small molecule compounds that might interfere with hormone-receptor interactions. Using the 6xHis tag for protein capture, researchers can develop plate-based assays to measure displacement of labeled growth hormone by test compounds. This application supports drug discovery research and mechanistic studies of growth hormone signaling pathways in porcine systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway.; The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Growth hormone-binding protein]: Secreted.
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*