Recombinant Pig Growth hormone receptor (GHR), partial

In Stock
Code CSB-EP009411PI
Abbreviation Recombinant Pig GHR protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
GHR; Growth hormone receptor; GH receptor; Somatotropin receptor
Species
Sus scrofa (Pig)
Source
E.coli
Expression Region
19-264aa
Target Protein Sequence
FSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Pig Growth Hormone Receptor (GHR) is expressed in E. coli and contains amino acids 19 to 264 of the full-length protein, representing a partial sequence. This protein comes engineered with a C-terminal 6xHis-tag, which helps streamline purification and detection processes. Its purity appears to exceed 85% as confirmed by SDS-PAGE analysis, suggesting it's suitable for various research applications. The product is intended for research use only and not for diagnostic or therapeutic purposes.

The Growth Hormone Receptor (GHR) plays a critical role in regulating growth and metabolism. It participates in the growth hormone signaling pathway, mediating growth hormone effects by binding to it and triggering downstream signaling cascades. This receptor seems essential for various physiological processes, making it an important target for studies on growth disorders and metabolic research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

This GHR fragment corresponds to the extracellular domain of GHR, which requires correct folding, including specific disulfide bond formation and potential glycosylation, for bioactivity (e.g., binding to growth hormone). E. coli, as a prokaryotic expression system, lacks the eukaryotic chaperones and post-translational modification machinery (e.g., glycosylation) necessary for proper folding of complex receptor domains. The absence of glycosylation and the potential for improper disulfide bonding make it highly unlikely that this protein is correctly folded or bioactive. The high purity indicates low impurity levels, but does not guarantee native conformation. Without experimental validation (e.g., circular dichroism for secondary structure or binding assays), the protein is probably misfolded and inactive for functional applications.

1. Protein-Protein Interaction Studies

If the recombinant GHR fragment is verified to be correctly folded (e.g., through biophysical or binding assays), it could be used to study interactions with growth hormone or ligands via techniques like surface plasmon resonance. However, if misfolded (which is likely), binding results may be unreliable due to altered binding sites or non-specific interactions. Any findings must be validated with full-length, eukaryotic-expressed GHR to ensure physiological relevance. The His tag facilitates immobilization but may contribute to artifacts.

2. Antibody Development and Characterization

This recombinant protein can be used as an immunogen for generating antibodies against linear epitopes within the GHR extracellular domain. The high purity supports consistent immunization and screening. However, antibodies produced may not recognize native, correctly folded GHR (e.g., on cell surfaces) due to conformational epitope differences. Antibody specificity should be validated against eukaryotic-expressed GHR for applications like Western blot or immunofluorescence.

3. Structural and Biochemical Analysis

The protein is suitable for basic biophysical characterization (e.g., circular dichroism to assess secondary structure, dynamic light scattering to monitor aggregation) to evaluate folding status. However, it is not appropriate for high-resolution structural studies (e.g., X-ray crystallography) or analyses assuming native conformation due to likely misfolding. These assays can help identify folding issues but not provide insights into functional structure.

4. In Vitro Competitive Binding Assays

This application requires a correctly folded protein for meaningful results. If the protein is misfolded (as expected), competitive binding assays will yield inaccurate data (e.g., false negatives/positives). Prior validation of growth hormone binding activity is essential. Without confirmation, this protein should not be used for drug screening or mechanistic studies; instead, use eukaryotic-expressed GHR.

Final Recommendation & Action Plan

Before using this recombinant GHR fragment for any functional application, it is critical to validate its folding state through biophysical assays (e.g., circular dichroism to check for expected β-sheet content, size-exclusion chromatography to assess oligomerization) and functional tests (e.g., growth hormone binding assays). If misfolding is confirmed, limit use to non-functional applications like antibody production, but always validate antibodies against native GHR. For reliable protein-protein interaction or binding studies, express the GHR extracellular domain in a eukaryotic system (e.g., mammalian or insect cells) to ensure proper folding and glycosylation. Avoid functional assays without prior activity confirmation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway.; The soluble form (GHBP) acts as a reservoir of growth hormone in plasma and may be a modulator/inhibitor of GH signaling.
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Growth hormone-binding protein]: Secreted.
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*