Recombinant Pig Growth hormone receptor(GHR)

Code CSB-CF009411PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P19756
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Sequence FSGSEATPAVLVRASQSLQRVHPGLETNSSGKPKFTKCRSPELETFSCHWTDGVRHGLQSPGSIQLFYIRRSTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTSNGGTVDQKCFSVEEIVQPDPPIGLNWTLLNISLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRNSEKYGEFSEVLYVTLPQMSPFACEEDFRFPWFLIIIFGIFGLTVILFLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYSDDSWVEFIELDIDDPDEKTEGSDTDRLLNNDHEKSLTILGAKEDDSGRTSCYEPDILETDFNANDVCDGTAEVAQPQRLKGEADLLCLDQKNQNNSPSNDAAPATQQPSVILAEENKPRPLIISGTDSTHQTAHTQLSNPSSLANIDFYAQVSDITPAGSVVLSPGQKNKAGISQCDMHLEVVSPCPANFIMDNAYFCEADAKKCIAMAPHVEVESRLAPSFNQEDIYITTESLTTTAGRSATAECAPSSEMPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
Source in vitro E.coli expression system
Gene Names GHR
Protein Names Recommended name: Growth hormone receptor Short name= GH receptor Alternative name(s): Somatotropin receptor Cleaved into the following chain: 1. Growth hormone-binding protein Short name= 2. GH-binding protein Short name= 3. GHBP Alternati
Expression Region 19-638
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to, and activates the JAK2/STAT5 pathway.; FUNCTION
Subcellular Location Cell membrane, Single-pass type I membrane protein, Note=On growth hormone binding, GHR is ubiquitinated, internalized, down-regulated and transported into a degradative or non-degradative pathway, SUBCELLULAR LOCATION: Growth hormone-binding protein: Secreted
Protein Families Type I cytokine receptor family, Type 1 subfamily
Database Links

STRING: 9823.ENSSSCP00000017873

UniGene: Ssc.93799

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway

Related Products

GHR Antibodies

GHR Antibodies for Sus scrofa (Pig)

GHR Proteins

GHR Proteins for Sus scrofa (Pig)

GHR ELISA Kit

GHR ELISA Kit for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.