Recombinant Pig Somatotropin(GH1)

In Stock
Code CSB-EP009407PI(A4)
Product Type Recombinant Protein
Size
Uniprot No. P01248
Relevance Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP009407PI(A4) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP009407PI(A4) could indicate that this peptide derived from E.coli-expressed Sus scrofa (Pig) GH1.
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MAAGPRTSALLAFALLCLPWTREVGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNLRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Research Area Developmental Biology
Source E.coli
Gene Names GH1
Protein Names Growth hormone
Expression Region 1-216aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 29.4 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Subcellular Location Secreted
Protein Families Somatotropin/prolactin family
Database Links

STRING: 9823.ENSSSCP00000018314

UniGene: Ssc.10492

Pathway Jak-STAT signaling pathway
PI3K-Akt signaling pathway

Related Products

GH1 Antibodies

GH1 Antibodies for Sus scrofa (Pig)

GH1 Proteins

GH1 Proteins for Sus scrofa (Pig)

GH1 ELISA Kit

GH1 ELISA Kit for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.