Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) (Active)

In Stock
Code CSB-MP023437RB
Abbreviation Recombinant Rabbit TFPI protein (Active)
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/ml can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC50 is 2.281-3.783 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC50 is 2.281-3.783 ng/mL.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
(TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)
Molecular Characterization
Species
Oryctolagus cuniculus (Rabbit)
Source
Mammalian cell
Expression Region
25-300aa
Target Protein Sequence
AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT
Mol. Weight
35.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Our Recombinant Rabbit TFPI offers an accurate replication of the native Tissue factor pathway inhibitor protein, a crucial component in cardiovascular research. Engineered using the TFPI gene derived from the rabbit species, this recombinant protein is meticulously produced in a mammalian cell system. Covering the 25-300 amino acid region, it presents the full length of the mature protein, embodying a faithful representation of the natural element.

Equipped with an N-terminal 10xHis-tag, this Recombinant Rabbit TFPI provides convenience for detection and purification tasks. It achieves a purity greater than 95%, as confirmed by SDS-PAGE, and harbors less than 1.0 EU/µg endotoxin, as determined by the LAL method. It has also proven its functional significance through binding ability tests in functional ELISA, demonstrating an EC50 of 2.281-3.783 ng/mL with an Anti-TFPI recombinant antibody. Available as either a liquid or lyophilized powder, our product caters to your specific research requirements.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Western blot

Review: Detection of these two purified pro_x005fteins by Western blot with anti-His. Lane Chi2, recombinant His-Chi2; lane CK, the 35 kDa protein TFPI (CUSABIO, Wuhan, China) added with the His-tag; lane M, marker, molecular quantity standard (250/150/100/70/50/40/35/25/20/15 kDa); lane Chi14, recombinant His-C.

By Anonymous

Target Background

Function
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Gene References into Functions
  1. Upregulated TF expression and increased plasma TF level during reperfusion period, reduced plasma TFPI-1 level during reperfusion period. PMID: 20193184
Subcellular Location
Secreted.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*