Name: Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) (Active)
Brand: CUSABIO
SKU: CSB-MP023437RB

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/mL can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC₅₀ is 2.281-3.783 ng/mL.

Target Names

TFPI

Uniprot No.

P19761

Research Area

Others

Alternative Names

(TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)

Molecular Characterization

Species

Oryctolagus cuniculus (Rabbit)

Source

Mammalian cell

Expression Region

25-300aa

Target Protein Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Mol. Weight

35.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Our Recombinant Rabbit TFPI offers an accurate replication of the native Tissue factor pathway inhibitor protein, a crucial component in cardiovascular research. Engineered using the TFPI gene derived from the rabbit species, this recombinant protein is meticulously produced in a mammalian cell system. Covering the 25-300 amino acid region, it presents the full length of the mature protein, embodying a faithful representation of the natural element.

Equipped with an N-terminal 10xHis-tag, this Recombinant Rabbit TFPI provides convenience for detection and purification tasks. It achieves a purity greater than 95%, as confirmed by SDS-PAGE, and harbors less than 1.0 EU/µg endotoxin, as determined by the LAL method. It has also proven its functional significance through binding ability tests in functional ELISA, demonstrating an EC50 of 2.281-3.783 ng/mL with an Anti-TFPI recombinant antibody. Available as either a liquid or lyophilized powder, our product caters to your specific research requirements.

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Western blot

Review: Detection of these two purified pro_x005fteins by Western blot with anti-His. Lane Chi2, recombinant His-Chi2; lane CK, the 35 kDa protein TFPI (CUSABIO, Wuhan, China) added with the His-tag; lane M, marker, molecular quantity standard (250/150/100/70/50/40/35/25/20/15 kDa); lane Chi14, recombinant His-C.

By Anonymous

Code	CSB-MP023437RB
Abbreviation	Recombinant Rabbit TFPI protein (Active)
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Rabbit TFPI at 1 μg/ml can bind Anti-TFPI recombinant antibody (CSB-RA023437MA01HU), the EC₅₀ is 2.281-3.783 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rabbit Tissue factor pathway inhibitor (TFPI) (Active)

Product Details

Citations

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage