Recombinant Rabbit Tissue factor pathway inhibitor(TFPI)

In Stock
Code CSB-EP023437RB
Product Type Recombinant Protein
Size US$2466
Uniprot No. P19761
Lead Time 3-7 business days
Relevance Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Extrinsic pathway inhibitor ;EPILipoprotein-associated coagulation inhibitor ;LACI
Species Oryctolagus cuniculus (Rabbit)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT
Research Area Others
Source E.coli
Gene Names TFPI
Expression Region 25-300a
Tag Info N-terminal 6xHis-tagged
Mol. Weight 35.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Subcellular Location Secreted
Database Links

KEGG: ocu:100009401

STRING: 9986.ENSOCUP00000007133

UniGene: Ocu.3263

Pathway Complement and coagulation cascades

Related Products

TFPI Proteins

TFPI Proteins for Oryctolagus cuniculus (Rabbit)

TFPI ELISA Kit

TFPI ELISA Kit for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.