Recombinant Rabies virus Glycoprotein(G),partial

In Stock
Code CSB-EP365970RID
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P03524
Relevance Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell mbrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365970RID could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP365970RID could indicate that this peptide derived from E.coli-expressed Rabies virus (strain ERA) (RABV) G.
Storage Buffer Tris-based buffer,50% glycerol
Species Rabies virus (strain PM) (RABV)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY
Source E.coli
Gene Names G
Expression Region 20-459aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 65.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Attaches the virus to host cellular receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell membrane. There is convincing in vitro evidence that the muscular form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecule (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells.
Subcellular Location Virion membrane, Single-pass type I membrane protein
Protein Families Lyssavirus glycoprotein family

Q&A and Customer Reviews

Q&A
Q:

I would like to know your opinion about endotoxin and aseptic removal if we will be using the protein HPLC method ?

A:
Thanks for your inquiry.
Regarding CSB-EP365970RID, if you will only use this protein for HPLC analysis, we think it's not necessary to remove the endotoxin removal,only needs to perform aseptic processing, however, it depends on your decision.
Q:

We are looking for Rabies G protein antigen or G+N protein antigen if available. You have several strains for Rabies G protein listed on your website. What was the antigen used to generate the antibody cat# CSB-PA14899A0Rb.
Please send me details for the antigen, expression systems, sizes offered, cost and lead time

A:
Very nice to receive your inquiry. The corresponding antigen for CSB-PA14899A0Rb is CSB-EP365970RID (20-459aa).
Code: CSB-EP365970RID
Name: Recombinant Rabies virus Glycoprotein(G),partial
Expression System: E.coli
Expression Region: 20-459aa; Partial; Virion surface domain
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Sequence:

KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY


Delivery Form: Lyophilized Powder
Storage Buffer before Lyophilization: Lyophilized from a 0.2 μm filtered 10 mM Tris-HCl, 1 mM EDTA, pH 8.0
Note: If your order size matches with our stock amount, we could deliver Lyophilized Powder. If not, we suggest to deliver Liquid Form, supplied in 10 mM Tris-HCl, 1 mM EDTA, pH 8.0, 50% glycerol.
Customer Reviews

Related Products

G Antibodies

G Antibodies for Rabies virus

G Proteins

G Proteins for Rabies virus (strain ERA)(RABV)

G Proteins for Rabies virus (strain ERA) (RABV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.