Recombinant Rat 72 kDa type IV collagenase (Mmp2)

Code CSB-BP014666RA
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP014666RA-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP014666RA
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Mmp2; 72 kDa type IV collagenase; EC 3.4.24.24; 72 kDa gelatinase; Gelatinase A; Matrix metalloproteinase-2; MMP-2) [Cleaved into: PEX]
Species
Rattus norvegicus (Rat)
Expression Region
110-662aa
Target Protein Sequence
YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Mol. Weight
64.1kD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues.; PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrin alpha-v/beta3 on the surface of blood vessels.
Gene References into Functions
  1. MMP-2-activated near-infrared fluorescence signal correlates with the severity of intimal thickening in arteriovenous fistula created for hemodialysis access. PMID: 30061060
  2. Suggest roles for MMP2/9 in the morphological evolution of vasculature in surgical fl aps. PMID: 27902934
  3. MMP2 expression mediates the development of cyclophosphamide-induced cardiomyopathy. PMID: 29504102
  4. Data show that retinoic acid receptor alpha (RARalpha) improved the renal function and attenuated the progression of glomerulosclerosis (GS) that was associated with the over-expression of matrix metalloproteinases MMP2 and MMP9. PMID: 28645189
  5. Secretagogin-dependent MMP2 release from neurons regulates neuroblast migration. PMID: 28223495
  6. High MMP2 expression is associated with seizures. PMID: 28501723
  7. Studied effect of all-trans retinoic acid (ATRA) on matrix metalloproteinase 2 (MMP-2), and MMP-9 expression/ activity, and rat bone marrow-derived mesenchymal stem cell migration. MMP-2/-9 expression levels were higher in ATRA-treated MSCs; MMP-2/-9 activity was enhanced with increasing doses. Scratch test showed ATRA promoted cell migration of MSCs. PMID: 28488074
  8. immediate postnatal nutritional programming induces increases in circulating and aortic MMP-2 activity with parallel aortic wall alterations, such as decreased elastin integrity and enhanced thickening PMID: 26547079
  9. This study showed that in addition to the general reduction in placental and fetal growth during uteroplacental ischemia, localized angiogenic imbalance and diminished MMP-2 and MMP-9 could cause further decrease in placental and myoendometrial vascularization and placental and fetal growth in distal vs proximal uterus in hypertensive pregnant rats. PMID: 28912068
  10. Thus, similar to pharmaceutical ACE inhibitor captopril the dipeptide IW may effectively inhibit ACE activity and prevent the age and hypertension associated rise of aortic stiffness. PMID: 27239047
  11. Hyperglycemic animals showed an increased area of collagen fibers in the prostate, which was composed both types of collagens. MMP-2 activity was significantly reduced in the hyperglycemic animals, while MMP-9 activity was very low and showed no alteration. PMID: 28989027
  12. High MMP2 expression is associated with uraemic vascular calcifications. PMID: 26333546
  13. High mmp2 expression is associated with Retinitis Pigmentosa. PMID: 27893855
  14. MMP-2 mediates sarcomere degeneration in oncostatin M-induced cardiomyocyte dedifferentiation. PMID: 27199120
  15. conclusion, this study revealed a novel function of canstatin for inducing cell migration of adult rat cardiac fibroblasts at least in part by ERK phosphorylation through MMP-2 secretion, possibly via actin cytoskeletal change. PMID: 28003226
  16. The increase in nuclear MMP-2 activity seen during stunning injury here, indicates yet unknown biological actions, other than lamin proteolysis, which may require more severe ischemia to effect. PMID: 27079252
  17. The present study investigated rat models of Feeney's freefall-induced brain injury combined with Achilles tendon rupture-induced heterotopic ossification. It analyzed the altered curves of MMP-9, MMP-2 and tissue inhibitor of metalloproteinase-1 (TIMP-1) in addition to the curves of gene expression. PMID: 28259914
  18. indicated that fibulin3 may reduce the levels of MMP2 and 9 and oxidative stress in hypertensive vascular remodeling. PMID: 27035767
  19. a role of miR-29b-3p in vascular calcification involves targeting MMP2. PMID: 28164126
  20. the endothelium under ANGII stimulation acts as a novel and key activator of latent pro-MT1MMP and pro-MMP2 in smooth muscle cells of rat aorta PMID: 26598508
  21. the D/P Cr ratio was correlated with effluent levels of TN-C (rho = 0.57, p < 0.001) and MMP-2 (rho = 0.73, p < 0.001). We suggest that TN-C in the effluents may be a diagnostic marker for peritoneal deterioration with EMT-like change PMID: 26770971
  22. cardiomyocytes in 2D culture synthesize matrix metalloproteinases MMP-2 and MMP-9 PMID: 26567576
  23. Report cross-talk between macrophages, smooth muscle cells, and endothelial cells in response to cigarette smoke alters MMP2/9 levels. PMID: 26318311
  24. Nuclear factor kappaB inhibitor pyrrolidine dithiocarbamate modulates myocardial MMP-2 expression and ameliorates cardiac remodelling in renovascular hypertension. PMID: 25816715
  25. High phosphate/calcium induces vascular smooth muscle cell calcification and differentiation to an osteochondrogenic phenotype with an associated increase in MMP-2 expression. PMID: 25987498
  26. Angiotensin II regulates MMP-2, MMP-9, and TIMP-1 expression and affects collagen deposition. PMID: 25867313
  27. Rosiglitazone attenuates the increased MMP2/9 activity induced by cigarette smoke. PMID: 25897215
  28. High matrix Methaloproteinase 2 expression is associated with oral cancer. PMID: 25605162
  29. Ischemia/reperfusion-activated MMP-2 leads to the degradation of cardiac MLCK. PMID: 25451385
  30. MMP-2 degraded Titin fragment in serum is related to induction of skeletal muscle atrophy. PMID: 25077715
  31. The increased activationof MMP2 in spontaneously hypertensive rat may also lead to endothelial hypermeability, apoptosis and vascular rarefaction. PMID: 23481598
  32. Effects of maternal diabetes on male offspring: high cell proliferation and increased activity of MMP-2 in the ventral prostate. PMID: 24988912
  33. MMP2 seems to contribute to early brain elevation of IL-1beta after transient ischemia PMID: 25108165
  34. Our results, taken together, demonstrated that MMP-2 and MMP-9 were involved in the development of H2S-induced acute lung injury and dexamethaxone exerted protective effects by alleviating the expression of MMP-2 and MMP-9. PMID: 24722316
  35. MMP-2 may have a functionally significant role in the etiology of degenerative disc disease PMID: 23621950
  36. The data suggest that Matrix metalloproteinases, and more specifically MMP-2, influence the growth of developing afferent neurites in the mammalian inner ear in vivo. PMID: 24935409
  37. Results suggest that MMP-2 and MMP-9 may play a significant role in blood-brain barrier disruption after alcohol abuse. PMID: 24966898
  38. Aortic dissection is initiated by MMP-2 overexpression as a result of increased NA release from sympathetic nervous endings in response to Ang II. PMID: 24194850
  39. intracellular inhibition of MMP-2 in cardiomyocytes increases contractility of aerobically perfused myocytes PMID: 24769238
  40. these results described a novel mechanism in atherosclerosis through PDGF-BB signaling in VSMC, in which MMP-2 expression is induced via extracellular signal-regulated kinases and p38 mitogen-activated protein kinase phosphorylation, as well as ROCK PMID: 24792035
  41. Brain MMMP-2 activity levels are increased following withdrawal from self-administered cocaine. PMID: 25326689
  42. MMP-2 -1306 C/T was shown to be involved in the pathogenesis of prostate cancer in a Turkish population. PMID: 25539555
  43. Demonstrate that ANGII regulates pro-MMP-2 protein expression via cell-specific pathways in rat aorta. PMID: 24907869
  44. In a rat mammary neoplasm model matrix metalloproteinase 2 localization, was localized to cancer cells and fibroblasts than in the stroma. PMID: 25343559
  45. The levels of active MMP-2 are downregulated in peripheral nerve during diabetes and with treatment withminocycline. PMID: 25158309
  46. The location of Mmp2 and activity can be detected by means of in situ zymography and confocal microcopy, and this methodology may provide a useful tool in studies on the role of gelatinases in tooth development, maturation and in pathological conditions. PMID: 22897943
  47. LA modulated increased MMP-2 and MMP-9 activities and decreased TIMP-1 and TIMP-2 levels during renal I-R. PMID: 24160412
  48. This study demonistrated that mmp2 throughout hippocampus at all ages but expression levels were highest during the first postnatal week. PMID: 24114974
  49. I/R injury in steatotic livers resulted in significant increases in expression of YKL-40 (9 fold), and activation of MMP-2 (15 fold)/MMP-9 (12 fold). PMID: 24380732
  50. Data indicate that mechanical stretch induces MMP-2 production in vascular smooth muscle cells (VSMC) via activation of Akt pathway, that is mediated by activation of PDGFR-beta signaling pathways. PMID: 23950935

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix. Membrane. Nucleus.
Protein Families
Peptidase M10A family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1