Home
Active Protein
Other
Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial (Active)

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial (Active)

^{In Stock}

Code	CSB-MP002207RA1b0
Abbreviation	Recombinant Rat Asgr1 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$156
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Rat Asgr1 at 2 μg/ml can bind Anti-ASGR1 recombinant antibody (CSB-RA002207MA3HU). The EC₅₀ is 2.336-2.712 ng/mL. Biological Activity Assay Activity ASGR1 Recombinant Monoclonal Antibody (CSB-RA002207MA3HU) captured on Protein A Chip can bind Recombinant Rat Asgr1 with an affinity constant of 0.12 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

≥ 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Rat Asgr1 at 2 μg/mL can bind Anti-ASGR1 recombinant antibody (CSB-RA002207MA3HU). The EC50 is 2.336-2.712 ng/mL.
②ASGR1 Recombinant Monoclonal Antibody (CSB-RA002207MA3HU) captured on Protein A Chip can bind Recombinant Rat Asgr1 with an affinity constant of 0.12 nM as detected by MetaSPR Assay (WeSPRTM 200).

Target Names

Asgr1

Uniprot No.

P02706

Alternative Names

Asialoglycoprotein receptor 1; ASGP-R 1; ASGPR 1; Hepatic lectin 1; HL-1; rHL-1

Species

Rattus norvegicus (Rat)

Source

Mammalian cell

Expression Region

61-284aa

Target Protein Sequence

QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN

Mol. Weight

29.6 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Asialoglycoprotein receptor 1 mediates the endocytosis of desialylated glycoproteins in hepatocytes, a pathway central to glycoprotein clearance and targeted drug delivery to the liver. This partial construct spanning residues 61–284 encompasses the carbohydrate recognition domain and demonstrates robust conformational integrity, binding an anti-ASGR1 recombinant antibody with a sub-nanomolar affinity constant of 0.12 nM as measured by MetaSPR and an EC50 of 2.336–2.712 ng/mL in functional ELISA. Mammalian expression ensures native post-translational modifications critical for lectin activity, supporting use in ligand-binding assays, competitive inhibition screens for glycan-targeted therapeutics, and therapeutic antibody epitope mapping where authentic receptor conformation is essential. The protein meets quality thresholds commonly required for SPR and BLI affinity characterization, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.

Gene References into Functions

a correlation exists between the progression of alcohol-associated liver injury, as defined by the severity of liver pathology, and an ethanol-induced decline in ASGP-R content. PMID: 12949020
Asialoglycoprotein receptor functions to help regulate the concentration of glycoproteins bearing sialic acid alpha 2,6GalNAc in the blood. PMID: 16286643

Subcellular Location

Membrane; Single-pass type II membrane protein.

Tissue Specificity

Expressed exclusively in hepatic parenchymal cells.

Database Links

KEGG: rno:24210

STRING: 10116.ENSRNOP00000025254

UniGene: Rn.44300

Promotions