Recombinant Rat Claudin-1 (Cldn1), partial

In Stock
Code CSB-EP005490RA1
Abbreviation Recombinant Rat Cldn1 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Cldn1; Claudin-1
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
29-81aa
Target Protein Sequence
QWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Rat Claudin-1 (Cldn1) is a high-quality research reagent designed for signal transduction studies, offering a reliable and well-characterized tool for investigating the function of rat Cldn1. Produced in E. coli, this partial Cldn1 protein spans amino acids 29–81aa of the target sequence and features a molecular weight of about 14 kDa, with N-terminal 10xHis-tagging and C-terminal Myc-tagging to facilitate purification and detection. A key advantage of this recombinant rat Cldn1 protein is its exceptional purity—greater than 90% as confirmed by SDS-PAGE, which minimizes non-specific background and ensures experimental accuracy. Available in both liquid and lyophilized powder formats (with flexible shipping options based on stock availability), it is tailored for use in applications such as protein-protein interaction assays, antibody generation, and structural biology studies (conduct a preliminary experiment for verification first). The partial nature of the protein, while focused on a functionally relevant region, allows for more targeted experimental design, and the dual-tag system simplifies downstream processing compared to many conventional recombinant proteins. This reagent is specifically optimized for rat research, providing researchers with a consistent, high-purity tool to advance their understanding of Cldn1-mediated signaling pathways.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN1 is required to prevent the paracellular diffusion of small molecules through tight junctions in the epidermis and is required for the normal barrier function of the skin. Required for normal water homeostasis and to prevent excessive water loss through the skin, probably via an indirect effect on the expression levels of other proteins, since CLDN1 itself seems to be dispensable for water barrier formation in keratinocyte tight junctions.
Gene References into Functions
  1. in Sertoli cells, testosterone acts through the receptor ZIP9 to trigger the non-classical signaling cascade, resulting in increased claudin expression and tight junction formation. PMID: 27164415
  2. identified four claudin isoforms (1, 3, 5, and 12) and showed that their expression levels were regulated as a group by copper PMID: 27038183
  3. Cardiotonic steroids may influence the formation of the blood-testis barrier via regulation of Cldn1 and Cldn11 expression. PMID: 25666991
  4. siRNA knockdown of Rab3Gap1 prevented plasma membrane Claudin-1 expression and the formation of a barrier competent epithelium PMID: 23685254
  5. Sodium butyrate enhanced intestinal barrier function through increasing Claudin-1 transcription via facilitating the association between SP1 and Claudin-1 promoter. PMID: 22684624
  6. claudin-1 is the major sealing component in the perineurium, and could be modulated to facilitate drug delivery or, potentially, reseal the barrier under pathological conditions. PMID: 22733753
  7. results confirm initiation of experimental periodontal disease is associated with reduction in expression of claudin-1 gene and protein. decreased level of critical tight junction protein may result in disruption of barrier function. PMID: 22092031
  8. Sequential biphasic changes in claudin1 and claudin4 expression occur during the homing of rat CC531 CRC cells to the liver. PMID: 21388515
  9. The blood brain barrier ultrastructure was disrupted and the expression of claudin-5 and claudin-1 decreased in the 4 and 72 h cerebral ischemia-reperfusion injury group respectively. PMID: 21626096
  10. tight junction proteins Cldn 1,3 and 5 show altered distribution after intestinal ischaemia/reperfusion injury in rats PMID: 19929946
  11. PATJ is mainly found at the tight junctions of paranodal loops, where it colocalized with claudin-1. PMID: 12403818
  12. Claudin-1 was strongly detected at the proximal complex but it was weak at distal complex of late differentiating ameloblasts. PMID: 15052661
  13. SP1 and SP3 bind to the Cldn1 promoter region, and that this interaction influences the expression of Cldn1 PMID: 17251524
  14. That differential expression of claudin 1 has functional implications for bile formation. PMID: 18197414
  15. increases at the distal portion of mature odontoblasts; may play an important role in the differentiation of odontoblasts PMID: 18208478
  16. Claudin-6 is a transmembrane protein of tight junctions in podocytes during development and under pathological conditions. PMID: 18367650

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.
Protein Families
Claudin family
Tissue Specificity
Detected in epididymis (at protein level). Detected in testis and epididymis.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*