Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Cldn1

Uniprot No.

P56745

Research Area

Signal Transduction

Alternative Names

Cldn1; Claudin-1

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

29-81aa

Target Protein Sequence

QWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.4 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Rat Claudin-1 (Cldn1) is a high-quality research reagent designed for signal transduction studies, offering a reliable and well-characterized tool for investigating the function of rat Cldn1. Produced in E. coli, this partial Cldn1 protein spans amino acids 29–81aa of the target sequence and features a molecular weight of about 14 kDa, with N-terminal 10xHis-tagging and C-terminal Myc-tagging to facilitate purification and detection. A key advantage of this recombinant rat Cldn1 protein is its exceptional purity—greater than 90% as confirmed by SDS-PAGE, which minimizes non-specific background and ensures experimental accuracy. Available in both liquid and lyophilized powder formats (with flexible shipping options based on stock availability), it is tailored for use in applications such as protein-protein interaction assays, antibody generation, and structural biology studies (conduct a preliminary experiment for verification first). The partial nature of the protein, while focused on a functionally relevant region, allows for more targeted experimental design, and the dual-tag system simplifies downstream processing compared to many conventional recombinant proteins. This reagent is specifically optimized for rat research, providing researchers with a consistent, high-purity tool to advance their understanding of Cldn1-mediated signaling pathways.

Target Background

Function

Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN1 is required to prevent the paracellular diffusion of small molecules through tight junctions in the epidermis and is required for the normal barrier function of the skin. Required for normal water homeostasis and to prevent excessive water loss through the skin, probably via an indirect effect on the expression levels of other proteins, since CLDN1 itself seems to be dispensable for water barrier formation in keratinocyte tight junctions.

Gene References into Functions

in Sertoli cells, testosterone acts through the receptor ZIP9 to trigger the non-classical signaling cascade, resulting in increased claudin expression and tight junction formation. PMID: 27164415
identified four claudin isoforms (1, 3, 5, and 12) and showed that their expression levels were regulated as a group by copper PMID: 27038183
Cardiotonic steroids may influence the formation of the blood-testis barrier via regulation of Cldn1 and Cldn11 expression. PMID: 25666991
siRNA knockdown of Rab3Gap1 prevented plasma membrane Claudin-1 expression and the formation of a barrier competent epithelium PMID: 23685254
Sodium butyrate enhanced intestinal barrier function through increasing Claudin-1 transcription via facilitating the association between SP1 and Claudin-1 promoter. PMID: 22684624
claudin-1 is the major sealing component in the perineurium, and could be modulated to facilitate drug delivery or, potentially, reseal the barrier under pathological conditions. PMID: 22733753
results confirm initiation of experimental periodontal disease is associated with reduction in expression of claudin-1 gene and protein. decreased level of critical tight junction protein may result in disruption of barrier function. PMID: 22092031
Sequential biphasic changes in claudin1 and claudin4 expression occur during the homing of rat CC531 CRC cells to the liver. PMID: 21388515
The blood brain barrier ultrastructure was disrupted and the expression of claudin-5 and claudin-1 decreased in the 4 and 72 h cerebral ischemia-reperfusion injury group respectively. PMID: 21626096
tight junction proteins Cldn 1,3 and 5 show altered distribution after intestinal ischaemia/reperfusion injury in rats PMID: 19929946
PATJ is mainly found at the tight junctions of paranodal loops, where it colocalized with claudin-1. PMID: 12403818
Claudin-1 was strongly detected at the proximal complex but it was weak at distal complex of late differentiating ameloblasts. PMID: 15052661
SP1 and SP3 bind to the Cldn1 promoter region, and that this interaction influences the expression of Cldn1 PMID: 17251524
That differential expression of claudin 1 has functional implications for bile formation. PMID: 18197414
increases at the distal portion of mature odontoblasts; may play an important role in the differentiation of odontoblasts PMID: 18208478
Claudin-6 is a transmembrane protein of tight junctions in podocytes during development and under pathological conditions. PMID: 18367650

Hide All

Subcellular Location

Cell junction, tight junction. Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.

Protein Families

Claudin family

Tissue Specificity

Detected in epididymis (at protein level). Detected in testis and epididymis.

Database Links

KEGG: rno:65129

STRING: 10116.ENSRNOP00000002640

UniGene: Rn.24293

Code	CSB-EP005490RA1
Abbreviation	Recombinant Rat Cldn1 protein, partial
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Claudin-1 (Cldn1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage