Recombinant Rat Claudin-1(Cldn1)

Code CSB-CF005490RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names Cldn1
Uniprot No. P56745
Alternative Names Cldn1; Claudin-1
Species Rattus norvegicus (Rat)
Expression Region 1-211
Target Protein Sequence MANAGLQLLGFILASLGWIGSIVSTALPQWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVSTIGMKCMRCLEDDEVQKMWMAV IGGIIFVISGLATLVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLSCSCPRKTTSYPTPRPYPKPTPSSGKDYV
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN1 is required to prevent the paracellular diffusion of small molecules through tight junctions in the epidermis and is required for the normal barrier function of the skin. Required for normal water homeostasis and to prevent excessive water loss through the skin, probably via an indirect effect on the expression levels of other proteins, since CLDN1 itself seems to be dispensable for water barrier formation in keratinocyte tight junctions.
Gene References into Functions
  1. in Sertoli cells, testosterone acts through the receptor ZIP9 to trigger the non-classical signaling cascade, resulting in increased claudin expression and tight junction formation. PMID: 27164415
  2. identified four claudin isoforms (1, 3, 5, and 12) and showed that their expression levels were regulated as a group by copper PMID: 27038183
  3. Cardiotonic steroids may influence the formation of the blood-testis barrier via regulation of Cldn1 and Cldn11 expression. PMID: 25666991
  4. siRNA knockdown of Rab3Gap1 prevented plasma membrane Claudin-1 expression and the formation of a barrier competent epithelium PMID: 23685254
  5. Sodium butyrate enhanced intestinal barrier function through increasing Claudin-1 transcription via facilitating the association between SP1 and Claudin-1 promoter. PMID: 22684624
  6. claudin-1 is the major sealing component in the perineurium, and could be modulated to facilitate drug delivery or, potentially, reseal the barrier under pathological conditions. PMID: 22733753
  7. results confirm initiation of experimental periodontal disease is associated with reduction in expression of claudin-1 gene and protein. decreased level of critical tight junction protein may result in disruption of barrier function. PMID: 22092031
  8. Sequential biphasic changes in claudin1 and claudin4 expression occur during the homing of rat CC531 CRC cells to the liver. PMID: 21388515
  9. The blood brain barrier ultrastructure was disrupted and the expression of claudin-5 and claudin-1 decreased in the 4 and 72 h cerebral ischemia-reperfusion injury group respectively. PMID: 21626096
  10. tight junction proteins Cldn 1,3 and 5 show altered distribution after intestinal ischaemia/reperfusion injury in rats PMID: 19929946
  11. PATJ is mainly found at the tight junctions of paranodal loops, where it colocalized with claudin-1. PMID: 12403818
  12. Claudin-1 was strongly detected at the proximal complex but it was weak at distal complex of late differentiating ameloblasts. PMID: 15052661
  13. SP1 and SP3 bind to the Cldn1 promoter region, and that this interaction influences the expression of Cldn1 PMID: 17251524
  14. That differential expression of claudin 1 has functional implications for bile formation. PMID: 18197414
  15. increases at the distal portion of mature odontoblasts; may play an important role in the differentiation of odontoblasts PMID: 18208478
  16. Claudin-6 is a transmembrane protein of tight junctions in podocytes during development and under pathological conditions. PMID: 18367650

Show More

Hide All

Subcellular Location Cell junction, tight junction. Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.
Protein Families Claudin family
Tissue Specificity Detected in epididymis (at protein level). Detected in testis and epididymis.
Database Links

KEGG: rno:65129

STRING: 10116.ENSRNOP00000002640

UniGene: Rn.24293

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
X