Recombinant Rat Complement C3 (C3), partial

Code CSB-YP360475RA
Abbreviation Recombinant Rat C3 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
C3Complement C3 [Cleaved into: Complement C3 beta chain; C3-beta-c; C3bc; Neutrophil chemotactic factor-2; ENCF-2); Complement C3 alpha chain; C3a anaphylatoxin; Neutrophil chemotactic factor-1; ENCF-1); Acylation stimulating protein; ASP; C3adesArg); Complement C3b alpha' chain; Complement C3c alpha' chain fragment 1; Complement C3dg fragment; Complement C3g fragment; Complement C3d fragment; Complement C3f fragment; Complement C3c alpha' chain fragment 2]
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
671-746aa
Target Protein Sequence
SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.0kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.; Derived from proteolytic degradation of complement C3, C3a anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. In chronic inflammation, acts as a chemoattractant for neutrophils.; Acts as a chemoattractant for neutrophils in chronic inflammation.; adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.
Gene References into Functions
  1. These data suggest that locally produced C3 is an important prosurvival mechanism in pancreatic beta-cells under a proinflammatory assault. PMID: 28582497
  2. Inhibition of C3 might improve the reactivity of superior mesenteric arteries to norepinephrine during hemorrhagic shock possibly through the downregulation of NO, ET1, TNF-alpha and reactive oxygen radicals. PMID: 26687560
  3. Recruited microglia/monocytes contribute to activation of complement in the aging retina, through local expression of C3 mRNA. PMID: 24705166
  4. The C3 and C3a receptor system may primarily be involved in the pathogenesis of renal remodeling in hypertensive rats. PMID: 23713944
  5. The expression of the complement component C3f and the complement component 4A have potential for use in post-transplant diagnosis of rejection. PMID: 23613499
  6. Abnormal activation of complement C3 in the spinal dorsal horn is closely associated with progression of neuropathic pain. PMID: 23588254
  7. The retinal irradiation with 670-nm light substantially reduces the propagation of complement3 in the retina following light-induced degeneration. PMID: 23181358
  8. Early response to blast injury involves activation of complement and TNFalpha, correlating with hippocampus and cerebral cortex immune-inflammatory damage. PMID: 22537900
  9. Carboxypeptidase B2 and complement C3 were more abundant in the cerebrospinal fluid of experimental autoimmune encephalomyelitis rats that did not respond to minocyline treatment. PMID: 22768796
  10. Increase of C3 expression occurs in light damaged retina leading to retinal degeneration. PMID: 22183312
  11. C3 and C4 may be involved in the immunopathology of allergic rhinitis. PMID: 17345707
  12. Perivascular adipose tissue-derived C3 stimulated adventitial fibroblast migration and differentiation via the c-Jun N-terminal kinase pathway and may contribute to adventitial remodeling in a deoxycorticosterone acetate-salt hypertensive model. PMID: 20864665
  13. downregulation in microglia while differentiating into ramified cells PMID: 12137932
  14. complement C3 expression is regulated by the bile acid receptor FXR PMID: 15590640
  15. Increased STAT-1, IRF-1 and complement component C3 in several models of liver transplant tolerance suggests that the STAT-1/IRF-1 apoptotic pathway and C3 may be involved in the tolerogenic mechanism. PMID: 16555329
  16. Complement C1 Inactivator Proteins, in addition to inhibition of the systemic complement activation, prevents myocardial cell injury via a direct inhibitory role in the local myocardial C3 activity PMID: 16996480
  17. C3a and C5a mediate distinct effects on blood pressure and circulating polymorphonuclear leukocytes in the rat. PMID: 19285573
  18. role for C3 in influencing the level of expression of CR3 by modulating the transcript levels encoding the CD11b alpha integrin protein PMID: 19710459

Show More

Hide All

Subcellular Location
Secreted.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*