Home
Protein
Recombinant Proteins
Recombinant Rat Fatty acid-binding protein, heart (Fabp3)

Recombinant Rat Fatty acid-binding protein, heart (Fabp3)

^{In Stock}

Code	CSB-MP007943RA
Abbreviation	Recombinant Rat FABP3 protein
MSDS	MSDS Datasheet
Size	$440
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Fabp3

Uniprot No.

P07483

Research Area

Cardiovascular

Alternative Names

Fabp3Fatty acid-binding protein; heart; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP

Species

Rattus norvegicus (Rat)

Source

Mammalian cell

Expression Region

2-133aa

Target Protein Sequence

ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To express the recombinant Rat FABP3 protein in mammalian cells, a DNA fragment encoding the Rat FABP3 protein (2-133aa) is inserted into a plasmid vector and transferred to the mammalian cells. Cells containing the plasmid are screened, cultured, and induced to express the FABP3 protein. The protein carries a N-terminal 6xHis-Myc tag. Lysing the cells allows for the collection of the recombinant Rat FABP3 protein, which is purified through affinity purification and then identified through SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the recombinant Rat FABP3 protein obtained is greater than 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.

Gene References into Functions

Significant down-regulation of heart-type fatty acid binding protein after myocardial ischemia might play an important role in myocardial injury and energy metabolism disorder. PMID: 21155221
H-FABP might have potential to be an early and quantitative parameter of clinical severity and prognosis in CO poisoning. PMID: 20375122
A complex interrelationship between glucose and fatty acids in the control of FABP gene expression; FABP3 and 5 may play a role in insulin secretion. PMID: 21099311
rat myocardial FABP gene maps to chromosome 5q36 and was detected in a preparation of total RNA isolated from adult rat heart PMID: 10561574

Subcellular Location

Cytoplasm.

Protein Families

Calycin superfamily, Fatty-acid binding protein (FABP) family

Tissue Specificity

Heart, but also skeletal muscle, kidney, brain and mammary gland.

Database Links

KEGG: rno:79131

STRING: 10116.ENSRNOP00000017325

UniGene: Rn.32566

Promotions