Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
Fabp3Fatty acid-binding protein; heart; Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP
Species
Rattus norvegicus (Rat)
Expression Region
2-133aa
Target Protein Sequence
ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To express the recombinant Rat FABP3 protein in mammalian cells, a DNA fragment encoding the Rat FABP3 protein (2-133aa) is inserted into a plasmid vector and transferred to the mammalian cells. Cells containing the plasmid are screened, cultured, and induced to express the FABP3 protein. The protein carries a N-terminal 6xHis-Myc tag. Lysing the cells allows for the collection of the recombinant Rat FABP3 protein, which is purified through affinity purification and then identified through SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the recombinant Rat FABP3 protein obtained is greater than 90%.
