Recombinant Rat Heme oxygenase 1 (Hmox1)

Code CSB-YP010583RA
Abbreviation Recombinant Rat Hmox1 protein
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Hmox1Heme oxygenase 1; HO-1; EC 1.14.14.18; HSP32
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
1-289aa
Target Protein Sequence
MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Gene References into Functions
  1. HO-1 activation could inhibit cecal ligation and puncture (CLP)-induced lung endoplasmic reticulum stress and attenuate CLP-induced acute lung injury PMID: 30013453
  2. the present study revealed that Bone marrow mesenchymal stem cells protected against liver Ischemia/reperfusion (I/R) injury injury via the promotion of HO1mediated autophagy. PMID: 29956785
  3. The present study indicates that overexpression of HO-1 in bone marrow-derived mesenchymal stem cells enhances the survival and the renal-epithelial differentiation of bone marrow-derived mesenchymal stem cells in the acute kidney injury microenvironment. PMID: 29749549
  4. These finding highlights NOS-dependent modulatory roles for HO. PMID: 29635898
  5. Results imply that octreotide-induced autophagy is dependent on heme oxygenase 1 (HO-1) during hepatic ischemia-reperfusion (I/R). PMID: 29385400
  6. voluntary physical exercise mitigates impaired spatial memory and neuropathological changes exhibited by the aging sedentary group, via elevated HO-1 activity, contributing to the antioxidant capacity in the aging brain. PMID: 29662895
  7. HO-1/BVD/CO pathway activation provides anti-nociceptive and anti-inflammatory effects on the zymosan-induced temporomandibular joint disorders hypernociception in rats PMID: 29362850
  8. n-propargyl caffeamide (PACA) attenuated LPS-induced NF-kB activation while activated Nrf2/HO-1 pathway. HO-1 inhibitor SnPP attenuated the effects of PACA on iNOS expression in LPS-challenged macrophages, possibly by regulating the cross-talk between HO-1 and NF-kB pathways. PMID: 29996121
  9. Effective inhibition of HO-1 expression may contribute to enhancement in the therapeutic effect of Photodynamic therapy (PDT) using talaporfin sodium against malignant meningioma. PMID: 29743446
  10. myricetin treatment significantly increased the activity of Nrf2/HO-1 pathway, strengthening antioxidative stress capacity evidenced by reversed activities of GPx and SOD, and decreased MDA production. PMID: 29147465
  11. findings suggested that L-arginine/NO reduces renal dysfunction associated with I/R of the kidney and may act as a trigger to regulate the NF-kappaB, HSP70 and Nrf2/HO-1 signaling cascades. PMID: 28854440
  12. autophagy is involved in the protective effects of HO-1/BM-MSCs on the transplanted liver after RSLT. Regulation of autophagy is primarily mediated through the ERK/mTOR signaling pathway. PMID: 28901391
  13. This study shows that systemic CO treatment can promote an anxiolytic-like effect and the expression of HO-1 enzymes in locus coeruleus cells. PMID: 28887196
  14. Abeta(1-42) is toxic to astrocytes, but induction of HO-1 affords protection against this toxicity due to formation of CO PMID: 28617444
  15. heme oxygenase-1-in bone marrow mesenchymal stem cells has an effect on microcirculation and energy metabolism following liver transplantation PMID: 28596681
  16. results implied that HO-1 upregulation suppressed oxidative stress induced by LPS, and the possible mechanism could be associated with Mfn1 and the PI3K/Akt pathway. PMID: 27830717
  17. Cardioprotective Effect of Selective Estrogen Receptor Modulator Raloxifene Are Mediated by Heme Oxygenase in Estrogen-Deficient Rat PMID: 28770019
  18. This study points to the modulatory effect of C. molmol on glutamate-NO-cGMP and Nrf2/ARE/HO-1 pathways in hyperammonemia. Therefore, C. molmol might be a promising protective agent against hyperammonemia. PMID: 28744340
  19. SERPINB1 decreased inflammation, ameliorated oxidative stress in the lung, and attenuated acute lung injury in rats with orthotopic autologous liver transplantation by activating HO-1 and it does so through STAT3 PMID: 28427999
  20. NIC pretreatment effectively inhibit CME-induced myocardial apoptosis and improve cardiac function. The protective effects are mediated through the activation of the Nrf2/HO-1 signaling in cardiomyocytes. PMID: 29412163
  21. H2O2 induced expression of HO-1. Exogenous HO-1 reduced phosphorylation of MLK3, MKK7 and JNK3. Consistent with its inhibitory effect on MLK3/MKK7/JNK3 signaling, exogenous HO-1 decreased H2O2-induced neuronal apoptosis and necrosis. It inhibited expression of Cdc42. Down-regulation of MLK3/MKK7/JNK3 signaling might be related to up-regulation of microRNA-137. PMID: 27864650
  22. Ischemic preconditioning attenuates ischemia/reperfusion injury in rat steatotic liver via heme oxygenase-1-mediated autophagy. PMID: 27852058
  23. Together with results showing involvement of TTF-1 in the TNF-alpha-induced increase in interleukin 1 beta and monocyte chemotactic protein 1 production, this study suggests that TTF-1 plays an important role in the mouse hypothalamus TNF-alpha-induced inflammatory response for regulating HO-1 gene expression. PMID: 29305861
  24. The renoprotection by hemin was accompanied by the reduction of inflammatory/oxidative mediators including, macrophage-inflammatory-protein-1alpha, macrophage-chemoattractant-protein-1 and 8-isoprostane, whereas HO-1, HO-activity and the total-anti-oxidant-capacity increased. PMID: 25460740
  25. Alpha-melanocyte-stimulating hormone induces vasodilation and exerts cardioprotection through the heme-oxygenase pathway in rat hearts. PMID: 28195947
  26. Since the rat is the preferred laboratory animal in experimental physiology and pathophysiology, the rat model of HO-1 deficiency may provide a novel tool for investigation of the role of this enzyme in renal function and disease. PMID: 27778153
  27. Downregulation of histone acetylation can inhibit manganese chloride-induced Nrf2 nuclear translocation and further inhibits the Nrf2/HO-1 pathway in manganese neurotoxicity syndromes. PMID: 29054681
  28. Fructose decreases HO-1 expression in maternal liver and placenta. PMID: 27545118
  29. Hemoglobin-activated astrocytes acquired resistance to hemin-induced toxicity via Nrf2/HO-1 pathway. This phenomenon can be considered as the adaptive self-defense in the pathological process of intracerebral hemorrhage. PMID: 29074371
  30. Biliary tract external drainage BTED protected multiple organs against severe acute pancreatitis related injuries via HO-1 upregulation. PMID: 28209258
  31. The expression of Nrf2/HO-1 increased in mesenteric arteries of portal hypertensive rats, which was related to oxidative stress. HO-1was involved in increased portal pressure and anomaly splanchnic hemodynamics in portal hypertensive rats. PMID: 28025064
  32. In order to elucidate the possible role of HO-1 in mediating the protective effects of ghrelin, tin protoporphyrin (SnPP) HO-1 blocker was administrated; it significantly attenuated the gastroprotective effect of ghrelin. In conclusion HO-1 activity significantly contributes toward ghrelin-mediated gastroprotection. PMID: 28635609
  33. HO-1 is a physiologic regulator of glomerular decay accelerating factor (DAF) and identify hemin analogues as inducers of functional glomerular DAF able to minimize complement component C3 fragment b (C3b) deposition. PMID: 27662796
  34. HO-1 Protects against Hypoxia/Reoxygenation-Induced Mitochondrial Dysfunction in H9c2 Cardiomyocytes PMID: 27138700
  35. the results of this study suggest that extratumoral HO-1+ macrophages may have an important role in prostate cancer. PMID: 27280718
  36. this study shows that overexpression of HO-1 in bone marrow mesenchymal stem cells increased their immunomodulatory effects protected liver allografts PMID: 28069109
  37. this experiments shown here indicate that HO-2 and HO-1 are differentially regulated across sexual experience and that the two CO-producing enzymes are expressed in distinct but overlapping populations of cells in medial preoptic area. PMID: 28088559
  38. Data show that nonylphenol (NP) increased serum alkaline phosphatase, lead to liver damage and can increase the expression of heme oxygenase-1 (HO1) and growth arrest and DNA-damage-inducible 45 beta protein (Gadd45b) genes and may modify the toxic effects on liver through induction of oxidative stress. PMID: 27590577
  39. Heme oxygenase 1 induction protects against diabetic nephropathy in streptozotocin-induced diabetic rats. PMID: 28229631
  40. remote ischemic preconditioning protects hepatic microcirculation by induction of HO and modulation of cytokine induced neutrophil chemoattractant in hepatic ischemia reperfusion injury PMID: 27672274
  41. Heme oxgenase-1 expression in concanavalin A-stimulated T cells that were co-cultured with adipose-derived stem cells revealed a significant increase compared with concanavalin A-stimulated T cells alone. TGF-beta and interleukin-10 increased and interferon-gamma decreased in the adipose-derived stem-cell-co-cultured T-cell group compared with other groups. A heme oxgenase inhibitor protected against these changes. PMID: 27391839
  42. HO-1 expression in response to Cd maintains cellular homeostasis during oxidative stress in NRK52E kidney cells PMID: 27658547
  43. alpha-Boswellic acid decreases oxidative stress. Nrf2/HO-1 pathway might play a role in the gastroprotective action of alpha-BA in ethanol-induced gastric injury in rats. PMID: 26992040
  44. The induced expression of HO-1 by fenofibrate appeared to be essential for mediating the protective effects of fenofibrate, as the inhibition of HO-1 activity significantly diminished the protective effects of fenofibrate against the GM-mediated death of sensory hair cells in cochlea PMID: 28290603
  45. Ethylbenzene induced oxidative stress, apoptosis, and up-regulation of HO-1 and Nrf2 in NRK-52E cells. PMID: 26381691
  46. HO-1 activity and protein are increased significantly in rats with acute liver injury induced by LPS, suggesting that HO-1 plays an important role in the pathogenesis of acute hepatic damage. PMID: 27432233
  47. 18beta-GA has a protective effect on MTX-induced nephrotoxicity with possible mechanisms of attenuating oxidative stress and inflammation through up-regulating the Nrf2/ARE signaling PMID: 27499091
  48. Intermittent hypoxia exposure also increased hepatic expression of HO-1 and iron-binding protein ferritin-1 at the late phase, in association with increase in serum iron, bilirubin, and hepatic levels of lipid peroxides, such as 4-hydroxy-2-nonenal (HNE). PMID: 27021659
  49. Expression of tumor necrosis factor (TNF)alphainduced protein 8-like 2 (TIPE2), matrix metalloproteinase-9 (MMP-9) and heme oxygenase-1 (HO-1) and mitogen-activated protein kinase (MAPK) signaling was modulated by Xuebijing injection (XBJ). PMID: 27666960
  50. rats treated with PAN. CONCLUSION: Depending on the type of injury, HO-1 overexpression in GEC may or may not reduce proteinuria. Reduced macrophage infiltration and preservation of nephrin expression are putative mechanisms underlying the protective effect of HO-1 overexpression following immune injury PMID: 27442135

Show More

Hide All

Subcellular Location
Microsome. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families
Heme oxygenase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*