Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Sost

Uniprot No.

Q99P67

Research Area

Stem Cells

Alternative Names

Sost; Sclerostin

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

29-213aa

Target Protein Sequence

FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Embark on a journey to unravel the mysteries of stem cell biology with our Recombinant Rat Sclerostin, a critical player in bone metabolism and regulation of bone formation. Sclerostin, encoded by the Sost gene, plays a decisive role in Wnt signaling pathway which is of vital importance in stem cell research and regenerative medicine. Boost your investigations with our first-rate and reliable product.

This highly bioactive protein, covering the full length of the mature protein from 29th to 213th amino acid, is crafted using a state-of-the-art E.coli expression system. To simplify your experimental proceedings, it features an N-terminal 10xHis-tag and a C-terminal Myc-tag. The product's integrity has been validated with an impressive purity level of over 90%, as determined by SDS-PAGE. It is available in both liquid form and lyophilized powder to offer maximum convenience and flexibility for your research requirements. Elevate the standard of your studies with our Recombinant Rat Sclerostin, designed to deliver consistency and excellence.

Target Background

Function

Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Gene References into Functions

alleviated the osteogenic differentiation of ectomesenchymal stem cells (EMSCs), and LNGFR enhanced the osteogenic differentiation of EMSCs by decreasing SOST PMID: 29226516
TNF-alpha might mediate alveolar bone loss via inducing expression of osteocytic RANKL and sclerostin in type 1 diabetes rats with periodontitis PMID: 29240821
These data suggest that sclerostin plays an important role in the bone remodeling of tooth movement. PMID: 28081119
a direct correlation between attenuated SOST expression and an increase in the osteogenic potential of UMR-106 cells, is reported. PMID: 27233518
In conclusion, naringin could prevent progress of disuse osteoporosis in rats, which may be mediated by increased periostin expression and subsequently inhibition of sclerostin and activation of Wnt/beta-catenin signaling pathways. PMID: 26541456
Scl-Ab increased osteoblast surface and bone formation, indicating direct bone anabolic effects, whereas TE reduced osteoclast surface with minimal effect on bone formation, indicating antiresorptive effects PMID: 25359699
Data indicate that sclerostin (SOST) gene expression is negatively regulated by histone deacetylase HDAC5 and positively by class I HDACs. PMID: 25012661
The results suggest that Sost mRNA expression in metaphyseal bone responds to mechanical unloading in an opposite direction to that observed in diaphyseal cortical bone. PMID: 23337040
Pharmacologic inhibition of sclerostin with Scl-Ab has no impact on articular cartilage remodeling in rats with posttraumatic osteoarthritis. PMID: 23233270
Confocal immunofluorescence tiling imaging revealed the spatio-temporal distributions of osterix and sclerostin in femurs from 3-day-old, 2-week-old and 4-week-old rats to be reciprocally exclusive at the tissue level. PMID: 22766096
The proportion of sclerostin-positive osteocytes in cortical bone was significantly higher. PMID: 22174402
Insulin-deficiency in insulin-dependent diabetes mellitus decreases osteoblastogenesis associated with inhibition of Wnt signaling through the increased expression of Sost and Dkk1 and the inhibition of Akt activation. PMID: 21567076
These results indicate that sclerostin inhibition by treatment with a sclerostin antibody increased bone formation, bone mass, and bone strength in aged male rats. PMID: 20641040
SOST regulation may play a role in mediating PTH action in bone PMID: 15946907
The anabolic effects of parathyroid hormone (PTH) are in line with the fall of SOST mRNA and protein in all the three bone segments examined; the rise of bone turnover supports a negative role of SOST in bone formation. PMID: 17549589
SOST expression in osteocytes of adult bone and its inhibition by PTH is mediated by MEF2A, C, and D transcription factors controlling the SOST bone enhancer. PMID: 17696759
Modulation of sclerostin levels appears to be a finely tuned mechanism by which osteocytes coordinate regional and local osteogenesis in response to increased mechanical stimulation, perhaps via releasing the local inhibition of Wnt/Lrp5 signaling PMID: 18089564

Hide All

Subcellular Location

Secreted.

Protein Families

Sclerostin family

Database Links

KEGG: rno:80722

STRING: 10116.ENSRNOP00000028238

UniGene: Rn.95369

Code	CSB-EP859165RA
Abbreviation	Recombinant Rat Sost protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP859165RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sost. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP859165RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sost. (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Sclerostin (Sost)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage