Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Species
Rattus norvegicus (Rat)
Expression Region
21-300aa
Target Protein Sequence
NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Boost your signal transduction studies with our Recombinant Rat Thyroglobulin (Tg), a key player in thyroid hormone synthesis. This crucial protein, synthesized and secreted by the follicular cells of the thyroid gland, plays a vital role in the endocrine system. Studying it could open new doors in our understanding of hormonal regulation and related disorders.
Produced in E.coli, this partial-length version of the protein focuses on the expression region from the 21st to the 300th amino acid, encompassing critical functional domains. For added utility, the protein features an N-terminal 6xHis-SUMO tag, facilitating both identification and purification processes. As a testament to our commitment to high-quality research tools, we've ensured that this product exceeds 90% purity, as confirmed by SDS-PAGE. You can also select from liquid or lyophilized powder forms based on your experimental requirements. Our Recombinant Rat Thyroglobulin (Tg), taking you one step closer to your research goals.
