Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Uniprot No.

P06882

Research Area

Signal Transduction

Alternative Names

TgThyroglobulin; Tg

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

21-300aa

Target Protein Sequence

NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

48.0kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Boost your signal transduction studies with our Recombinant Rat Thyroglobulin (Tg), a key player in thyroid hormone synthesis. This crucial protein, synthesized and secreted by the follicular cells of the thyroid gland, plays a vital role in the endocrine system. Studying it could open new doors in our understanding of hormonal regulation and related disorders.

Produced in E.coli, this partial-length version of the protein focuses on the expression region from the 21st to the 300th amino acid, encompassing critical functional domains. For added utility, the protein features an N-terminal 6xHis-SUMO tag, facilitating both identification and purification processes. As a testament to our commitment to high-quality research tools, we've ensured that this product exceeds 90% purity, as confirmed by SDS-PAGE. You can also select from liquid or lyophilized powder forms based on your experimental requirements. Our Recombinant Rat Thyroglobulin (Tg), taking you one step closer to your research goals.

Target Background

Function

Acts as a substrate for the production of iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3). The synthesis of T3 and T4 involves iodination of selected tyrosine residues of TG/thyroglobulin followed by their oxidative coupling. Following TG re-internalization and lysosomal-mediated proteolysis, T3 and T4 are released from the polypeptide backbone leading to their secretion into the bloodstream. One dimer produces 7 thyroid hormone molecules.

Involvement in disease

Defects in Tg are a cause of a form of hypothyroidism in rdw rat.

Subcellular Location

Secreted.

Protein Families

Type-B carboxylesterase/lipase family

Tissue Specificity

Specifically expressed in the thyroid gland.

Database Links

STRING: 10116.ENSRNOP00000009241

UniGene: Rn.10429

Code	CSB-EP023442RA
Abbreviation	Recombinant Rat Thyroglobulin protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Thyroglobulin (Tg), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage