Recombinant Rat Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a), partial (Active)

In Stock
Code CSB-MP023977RA
Abbreviation Recombinant Rat Tnfrsf1a protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA.Immobilized Rat Tnf(CSB-MP325438RA) at 4 μg/ml can bind Rat Tnfrsf1a. The EC50 is 66.99-76.40 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Rat Tnf(CSB-MP325438RA) at 4 μg/mL can bind Rat Tnfrsf1a. The EC50 is 66.99-76.40 ng/mL.
Target Names
Uniprot No.
Alternative Names
Tumor necrosis factor receptor superfamily member 1A; Tumor necrosis factor receptor 1; TNF-R1; Tumor necrosis factor receptor type I; TNF-RI; TNFR-I; p55; p60; CD antigen CD120a
Species
Rattus norvegicus (Rat)
Source
Mammalian cell
Expression Region
30-211aa
Target Protein Sequence
LVPSLGDREKRDNLCPQGKYAHPKNNSICCTKCHKGTYLVSDCPSPGQETVCEVCDKGTFTASQNHVRQCLSCKTCRKEMFQVEISPCKADMDTVCGCKKNQFQRYLSETHFQCVDCSPCFNGTVTIPCKEKQNTVCNCHAGFFLSGNECTPCSHCKKNQECMKLCLPPVANVTNPQDSGTA
Mol. Weight
49.0 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis.
Gene References into Functions
  1. Activation of TNF-alpha receptor 1 in the subfornical organ (SFO) contributes to sympathetic excitation in heart failure rats by increasing inflammation and renin-angiotensin system activity PMID: 28710070
  2. Resveratrol restores the antinociceptive effect of morphine by reversing morphine infusion-induced spinal cord neuroinflammation and increase in TNFR1 expression. The reversal of the morphine-induced increase in TNFR1 expression by resveratrol is partially due to reversal of the morphine infusion-induced increase in HDAC1 expression. PMID: 26078221
  3. TNF plays an inhibitory role in modulating myocardial SDF-1 production and blockade of TNF signaling by ablation of TNFR1 and TNFR2 genes increased SDF-1 expression in the heart. These data expand on TNF signaling-initiated mechanisms in myocardium, which may lend a more complete understanding of SDF-1 and TNFR-derived actions in hopes of advancing ischemic heart injury treatments. PMID: 27979472
  4. miR-29a might promote the apoptosis of pancreatic acinar cells via up-regulating the expression of its target gene TNFRSF1A. PMID: 27239114
  5. TNFR1 and TNFR2 regulate voltage-gated sodium channels in rat dorsal root ganglia PMID: 26504355
  6. Co-culture with bone marrow stromal cells protects PC12 neurons from TNF-alpha-induced apoptosis by inhibiting the TNFR1/caspase 8 signaling pathway. PMID: 25738414
  7. Data indicate that combination of tumor necrosis factor (TNF) and TNF receptor (TNFR) on the cell membrane activated two downstream signal pathways. PMID: 23134577
  8. Blocking TNF-alpha binding to TNFR1 by CAY10500 intravenously slightly mitigates pulmonary inflammation, but cannot improve the pulmonary function, indicating the limited role of TNFR1 pathway in circulating inflammatory cell in ECC-induced ALI. PMID: 24599692
  9. antisense to IL-6 receptor subunit gp130 (gp130), but not to tumor necrosis factor receptor type 1 (TNFR1), inhibited hyperalgesia in NLB rats. However, antisense against either gp130 or TNFR1 inhibited sound stress-induced enhancement of hyperalgesia. PMID: 23706525
  10. Ultra-low dose naloxone enhances the antihyperalgesia and antiallodynia effects of morphine in rats with partial sciatic nerve transection, possibly by reducing TNF-alpha and TNFR1 expression in the spinal dorsal horn. PMID: 24257399
  11. Ozone suppresses joint swelling in rheumatoid arthrtis by down-regulating synovial TNF-alpha and TNF-R2 and up-regulating TNF-R1 in the joint. PMID: 23052485
  12. exDCs transduced to overexpress soluble tumor necrosis factor (TNF) receptor1 (sTNFR1) produce functional cargo that is secreted and that blocks TNF-alpha bioavailability in vitro. PMID: 23756688
  13. The microglial TNFalpha receptor p55 pathway plays a more important role than the TNFalpha-p75 pathway in the pathogenesis of sciatic nerve injury pain. PMID: 22652595
  14. Fas and TNFR1 are expressed in the CA1 and CA3 regions after global ischemia/reperfusion in rats. Bcl-2 overexpression decreases the expression of Fas and TNFR1 and cell apoptosis after global IR. PMID: 21868309
  15. Tnfrsf1a, Birc2 and Birc3 of Schwann cells, not originally regarded as XIAP, were mainly responsible for the inflammation-mediated anti-apoptosis of peripheral nerves. PMID: 23028454
  16. Intra-articular injection of ozone can attenuate synovitis in rats with rheumatoid arthritis, which may involve the inhibition of TNF-alpha and TNFR II activity and enhancement of TNFR I activity in the synovium. PMID: 21690068
  17. The moxibustion therapies could reduce intestinal inflammation and restore intestinal epithelium barrier disruption in CD, which might be due to down-regulating TNF-alpha, TNFR1, and TNFR2 in intestinal mucosa and improving intestinal epithelium morphology. PMID: 21359923
  18. Moxibustion may inhibit colonic epithelial cell apoptosis by reducing the high expression of TNF-alpha and TNFR1 to protect the defective colonic epithelial barrier in Crohn disease model rats. PMID: 22531889
  19. Data show that cerebral ischemia and organ culture induce expression of TNF-alpha and its receptors TNFR1 and 2 in the walls of cerebral arteries and that upregulation is transcriptionally regulated via the MEK/ERK pathway. PMID: 21871121
  20. Up-regulation of p55 in dorsal root ganglia neurons may be involved in the sensory transmission from facet joint injury. PMID: 17468886
  21. Data show that TNFR1 and TNFR2 are constitutively expressed in Kupffer cells and their expression is strongly increased by somatostatin. PMID: 21692635
  22. Vagal nerve stimulation can rectify ischaemia-induced cardiac dysfunction partly via inhibition of a TNF-alpha-mediated signalling pathway. PMID: 21362018
  23. doxorubicin increases diaphragm sensitivity to TNF by upregulating TNFR1, thereby causing respiratory muscle weakness PMID: 21097524
  24. Cultured hypothalamic neurons express IL-1RI and that LPS + IFN-gamma increases this expression. PMID: 20619468
  25. Adrenomedullin can increase the expression of TNF-beta and TNFR in renal early trauma. PMID: 20092780
  26. Data show that exercise training enhanced the ability of adipocytes to secrete TNF-alpha with reduced secretion of type 1 soluble TNF receptor, and provoked the greater expressions of mTNFR1 in adipocyte crude membrane. PMID: 12052444
  27. ASK1 may be involved in the mechanism of seizure-induced neuronal death downstream of a TNFR1 death-signalling complex. PMID: 12786973
  28. Both TNF receptors were detected, with TNF-R1 being prominent on bronchial epithelial cells and endothelial cells, and TNF-R2 being expressed by nearly all cell types PMID: 12849708
  29. Up-regulation of tumor necrosis factor receptor I in tumor-bearing rats is associated with cancer-related cachexia PMID: 12851692
  30. The expression of TNFR1 and TNFR2 after spinal cord injury may contribute to posttraumatic inflammatory responses of TNF-alpha PMID: 14552870
  31. In conclusion, protein deficiency in endotoxic rats increases the expression of TNFR-I and TNFR-II in all organs studied and TNF-alpha in selected ones. PMID: 14625205
  32. Increased TNfr1 receptor immunoreactivity in axotomized neurons may play a pivotal role in the connection between the occurrence of the injury and the initiation of apoptotic processes resulting in elimination of damaged neurons. PMID: 15033431
  33. At all spinal levels, TNFR1 receptor is constitutively expressed on cells and afferent fibers within the dorsal root ganglia, afferent fibers of the dorsal root, dorsal root entry zone and within lamina I and II of the dorsal horn. PMID: 15464762
  34. We provide evidence that non-neuronally synthesized TNFalpha may directly act on primary afferent neurons via TNFR1 but not TNFR2. PMID: 15509749
  35. It is concluded that the shedding of TNFR1 receptor may represent an important post-traumatic physiological response aimed at reducing the proapoptotic effect of TNF-alpha. PMID: 16083358
  36. Upregulation of TNF-alpha and TNFR1 in dorsal root ganglia and spinal dorsal horn is essential for initiation but not for maintenance of neuropathic pain induced by L5 ventral root transection. PMID: 16675114
  37. Cellular distribution of TNFR1 in the dorsal root ganglia may reflect different pathways by which TNF-alpha effect on the primary sensory neurons can be mediated following nerve injury. PMID: 16705482
  38. EGFR, FGFR and TNFR1 mRNA expression was equal or lower than in resting liver, HGFR expression after I/R was stronger than in the control. PMID: 16804967
  39. cyclic tensile strain inhibited the IL-1beta-stimulated synthesis of TNF-alpha, TNFR2, and iNOS PMID: 17049356
  40. study of TNF-alpha and TnfrR1 protein synthesis and expression patterns in sciatic nerve of controls and rats under systemic challenge with lipopolysaccharide. PMID: 17873366
  41. These results suggest that an autocrine loop involving TNF-alpha, TNFR1 and TNFR2 contributes to the production of beta-1,4-GalT I and V mRNA in response to inflammation. PMID: 17917074
  42. Data show that cultured Schwann cells express both tumor necrosis factor receptor 1 (TNFR1) and TNFR2, and that activation of these receptors by TNF-alpha promotes expression of TNF-alpha. PMID: 18205044
  43. these data suggest that tumor necrosis factor receptor 1 induces induces interleukin-6 upregulation and neuropathic pain through NF-kappaB, but not p38 MAPK activation in the spinal cord PMID: 18938092
  44. results demonstrate the existence of TNFR1 and TNFR2 in rat corpus luteum and suggest the involvement of TNF-alpha in rat CL regression following parturition PMID: 18990246
  45. These data suggest that TNFRI-mediated signals in the radioresistant tissues contribute to disease progression, whereas TNFRI-mediated signals in the radiosensitive tissues can contribute to protection from disease. PMID: 19180511

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*