Recombinant Rat Vesicle-associated membrane protein 2(Vamp2),partial

Code CSB-EP025781RA1
Product Type Recombinant Protein
Size US$2466
Uniprot No. P63045
Relevance Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK
Research Area Cancer
Source E.coli
Gene Names Vamp2
Protein Names Recommended name: Vesicle-associated membrane protein 2 Short name= VAMP-2 Alternative name(s): Synaptobrevin-2
Expression Region 2-94aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 14.1 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the targeting and/or fusion of transport vesicles to their target membrane (By similarity). Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, Cell membrane
Protein Families Synaptobrevin family
Tissue Specificity Nervous system specific. A higher level expression is seen in the brain as compared to the spinal cord.
Database Links

KEGG: rno:24803

STRING: 10116.ENSRNOP00000054114

UniGene: Rn.12939

Pathway Secreted Extracellular Vesicles
Synaptic vesicle cycle

Related Products

Vamp2 Antibodies

Vamp2 Antibodies for Rattus norvegicus (Rat)

Vamp2 Proteins

Vamp2 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.