Recombinant Rat Vesicle-associated membrane protein 2(Vamp2)

Code CSB-CF025781RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P63045
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST
Source in vitro E.coli expression system
Gene Names Vamp2
Protein Names Recommended name: Vesicle-associated membrane protein 2 Short name= VAMP-2 Alternative name(s): Synaptobrevin-2
Expression Region 2-116
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the targeting and/or fusion of transport vesicles to their target membrane (By similarity). Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Single-pass type IV membrane protein, Cell junction, synapse, synaptosome, Cell membrane
Protein Families Synaptobrevin family
Tissue Specificity Nervous system specific. A higher level expression is seen in the brain as compared to the spinal cord.
Database Links

KEGG: rno:24803

STRING: 10116.ENSRNOP00000054114

UniGene: Rn.12939

Pathway Secreted Extracellular Vesicles
Synaptic vesicle cycle

Related Products

Vamp2 Antibodies

Vamp2 Antibodies for Rattus norvegicus (Rat)

Vamp2 Proteins

Vamp2 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.