Recombinant Rat Vesicle-fusing ATPase (Nsf), partial

Code CSB-RP154574r(N)
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Nsf
Uniprot No.
Research Area
Others
Alternative Names
Nsf; Erg1; Vesicle-fusing ATPase; EC 3.6.4.6; N-ethylmaleimide-sensitive fusion protein; NEM-sensitive fusion protein; Vesicular-fusion protein NSF
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
7-209aa
Target Protein Sequence
QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
26.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling.
Gene References into Functions
  1. We have found increased expression of NSF gene in basolateral amygdala and perirhinal cortex in groups of rats undergoing taste habituation. PMID: 26839712
  2. TCST increases the expression of NSF in the hippocampus of adult rats with focal cerebral ischemia, which may contribute to the protection of the injured brain. PMID: 25480573
  3. NSF-GluR2 interactions increase in the nucleus accumbens after cocaine withdrawal. PMID: 24599450
  4. a model of NSF-mediated disassembly in which the reaction is initiated by a 1:1 interaction between alpha-SNAP and the ternary SNARE complex, followed by NSF binding. PMID: 23836889
  5. The interaction of N-ethylmaleimide-sensitive factor (NSF) with glutamate receptor 2 (GluR2) is necessary for fear memory consolidation. PMID: 21106836
  6. Synaptic stabilization of AMPA receptors by NSF involves disruption of GluR2-PICK1 interactions. PMID: 11931741
  7. NSF interaction is necessary for rapid incorporation of alpha-amino-3-hydroxy-5-methylisoxazolepropionate (AMPA) receptor subunits into synapses and is sufficient to confer this property on the AMPA receptor GluR3 subunit. PMID: 15797712
  8. These data demonstrate that spontaneous recurrent seizure impairs spatial learning memory and suggest that the down-regulation of NSF expression pattern in the hippocampus and the loss of DA neurons in ventral tegmental area. PMID: 16039622
  9. Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein PMID: 16461345
  10. The functional interaction between three bona fide regulators of neurotransmitter release, such as GABAB receptor (GBR), NEM sensitive fusion (NSF) and Protein Kinase C, could shed new light on the modulation of presynaptic GBR action. PMID: 16724110
  11. A yeast two-hybrid screen using NSF as bait identified Rab11-FIP3 and the Pak-binding nucleotide exchange factor betaPIX as putative binding partners PMID: 16795052
  12. Concomitant with the decrease in NSF, GluR2 and GluR3 were decreased and GluR1 was conversely increased in the postsynaptic density fraction 24 h after complete Freund adjuvant injection PMID: 18598260

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
AAA ATPase family
Tissue Specificity
Detected in brain (at protein level).
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*