Recombinant Sheep Protransforming growth factor alpha(TGFA),partial

Code CSB-EP023445SH
Product Type Recombinant Protein
Size US$2466
Uniprot No. P98135
Relevance TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP023445SH could indicate that this peptide derived from E.coli-expressed Ovis aries (Sheep) TGFA.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP023445SH could indicate that this peptide derived from E.coli-expressed Ovis aries (Sheep) TGFA.
Storage Buffer Tris-based buffer,50% glycerol
Alias EGF-like TGF ;ETGFTGF type 1
Species Ovis aries (Sheep)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ
Research Area Others
Source E.coli
Gene Names TGFA
Protein Names Recommended name: Protransforming growth factor alpha Cleaved into the following chain: 1. Transforming growth factor alpha Short name= 2. TGF-alpha Alternative name(s): EGF-like TGF Short name= ETGF TGF type 1
Expression Region 24-97aa
Tag Info N-terminal GST-tagged
Mol. Weight 34.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
Subcellular Location Transforming growth factor alpha: Secreted, extracellular space, SUBCELLULAR LOCATION: Protransforming growth factor alpha: Cell membrane, Single-pass type I membrane protein
Tissue Specificity Skin.
Database Links

UniGene: Oar.396

Pathway ErbB signaling pathway
Estrogen signaling pathway
MAPK signaling pathway
PI3K-Akt signaling pathway
Ras signaling pathway

Related Products

TGFA Antibodies

TGFA Antibodies for Ovis aries (Sheep)

TGFA Proteins

TGFA Proteins for Ovis aries (Sheep)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.