Recombinant Sheep Somatotropin (GH1)

Code CSB-YP009407SH
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009407SH
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009407SH-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP009407SH
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP009407SH
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
GH1
Uniprot No.
Alternative Names
GH1; Somatotropin; Growth hormone
Species
Ovis aries (Sheep)
Expression Region
28-217
Target Protein Sequence
FPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAP TGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIL ALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKC RRFGEASCAF
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
Gene References into Functions
  1. Association analyses showed that both g.498G>C and g.616G>A GH polymorphisms were significantly associated with several growth traits (at P < 0.01 or P < 0.05) in three investigated sheep breeds. PMID: 27706626
  2. The effect leptin, orexin-A, and ghrelin on the secretion of luteinizing hormone (LH) and growth hormone by adenohypophyseal explants obtained from normally fed or fasted ewes during the breeding and nonbreeding seasons. PMID: 24906931
  3. The results showed that the growth hormone genotypes are associated with estimated breeding values of growth traits. PMID: 21328104
  4. The simultaneous increase of expression of hypothalamic NPY suggests NPY involvement in the regulation of psychoemotional stress through the somatotrophic axis in the female lambs. PMID: 20675289
  5. These data are consistent with the effects of LPS on GH secretion originating through peripheral cytokine presentation to the pituitary, as well as a potential to act directly on selective populations of pituitary cells via CD14. PMID: 15899940
  6. Results show that in comparison to the product of the ovine growth hormone (GH)2-N gene copy, the postulated product of the GH2-Z gene copy, the G9R/G63S mutein, has a higher affinity to the growth hormone receptor and elevated biological activity. PMID: 17850798
  7. Results describe thet pulsatility of cerebrospinal fluid and plasma ghrelin levels in relation to growth hormone secretion and food intake in the sheep, and the effects of exogenous ghrelin on GH and feeding behavior. PMID: 18673413
  8. study has demonstrated for the first time that ghrelin differentially modulates growth hormone secretory response to growth hormone-releasing hormone according to feeding states in ruminant animals PMID: 19342191

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Somatotropin/prolactin family
Database Links

KEGG: oas:443329

UniGene: Oar.641

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X