Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

hly

Uniprot No.

Q2G1X0

Research Area

Others

Alternative Names

hly; hla; SAOUHSC_01121Alpha-hemolysin; Alpha-HL; Alpha-toxin

Species

Staphylococcus aureus (strain NCTC 8325)

Source

E.coli

Expression Region

27-319aa

Target Protein Sequence

ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

49.3kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To prepare this Recombinant S. aureus hly protein, the recombinant DNA was required, which was generated by fusing the hly gene with N-terminal 6xHis-SUMO tag sequence. Once the recombinant DNA was amplified and purified, a protein expression system, E.coli, was needed for this hly protein production. After purification, a premium hly recombinant proteinwas obtained. According to SDS-PAGE, its purity turns out to be 90%+.

hly, also known as hla, is a gene encoding a protein named Alpha-hemolysin or Alpha-toxin that is the major cytotoxic agent released by bacterium Staphylococcus aureus. The encoded protein Hla can lyse many types of cells, including human monocytes, lymphocytes, red blood cells, platelets and endothelial cells. It is secreted outside the cell in the form of a soluble monomer, and then aggregates on various cell membranes in the form of a heptamer. Small molecules in the cytoplasm, such as ATP, leak out of the cell through the pores, irreversibly changing the osmotic pressure of the cell. disrupt the integrity of cell membranes.

Target Background

Function

Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Inhibits host neutrophil chemotaxis to the lesion region (Probable). Heptamer oligomerization and pore formation is required for lytic activity.

Gene References into Functions

We now show that ADAM10 is critical for alpha-hemolysin-mediated activation of the NLRP3 inflammasome in human monocytes as siRNA knockdown or chemical blockade of ADAM10-alpha-hemolysin interaction leads to diminished inflammasome activation and cell death by reducing the available ADAM10 on the cell surface. PMID: 27043625
Staphylococcus aureus hemolysin A disrupts cell-matrix adhesions in human airway epithelial cells. PMID: 24918472
Succeeded in preparing crystals of the heptameric form of alpha-hemolysin without any detergent but with 2-methyl-2,4-pentanediol (MPD), and determined its structure. PMID: 21280135
Staphylococcus aureus alpha-hemolysin activates the NLRP3-inflammasome in human and mouse monocytic cells PMID: 19826485
The wide vestibule leading into the alpha-hemolysin pore helps to orient negatively charged synthetic alpha-helical peptides for translocation. PMID: 16866363

Hide All

Subcellular Location

Secreted.

Protein Families

Aerolysin family

Database Links

KEGG: sao:SAOUHSC_01121

STRING: 93061.SAOUHSC_01121

Code	CSB-EP639324FLF
Abbreviation	Recombinant Staphylococcus aureus hly protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Staphylococcus aureus Alpha-hemolysin (hly)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage