Recombinant Staphylococcus aureus Alpha-hemolysin (hly)

In Stock
Code CSB-EP639324FLF
Abbreviation Recombinant Staphylococcus aureus hly protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
hly
Uniprot No.
Research Area
Others
Alternative Names
hly; hla; SAOUHSC_01121Alpha-hemolysin; Alpha-HL; Alpha-toxin
Species
Staphylococcus aureus (strain NCTC 8325)
Source
E.coli
Expression Region
27-319aa
Target Protein Sequence
ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

To prepare this Recombinant S. aureus hly protein, the recombinant DNA was required, which was generated by fusing the hly gene with N-terminal 6xHis-SUMO tag sequence. Once the recombinant DNA was amplified and purified, a protein expression system, E.coli, was needed for this hly protein production. After purification, a premium hly recombinant proteinwas obtained. According to SDS-PAGE, its purity turns out to be 90%+.

hly, also known as hla, is a gene encoding a protein named Alpha-hemolysin or Alpha-toxin that is the major cytotoxic agent released by bacterium Staphylococcus aureus. The encoded protein Hla can lyse many types of cells, including human monocytes, lymphocytes, red blood cells, platelets and endothelial cells. It is secreted outside the cell in the form of a soluble monomer, and then aggregates on various cell membranes in the form of a heptamer. Small molecules in the cytoplasm, such as ATP, leak out of the cell through the pores, irreversibly changing the osmotic pressure of the cell. disrupt the integrity of cell membranes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Inhibits host neutrophil chemotaxis to the lesion region (Probable). Heptamer oligomerization and pore formation is required for lytic activity.
Gene References into Functions
  1. We now show that ADAM10 is critical for alpha-hemolysin-mediated activation of the NLRP3 inflammasome in human monocytes as siRNA knockdown or chemical blockade of ADAM10-alpha-hemolysin interaction leads to diminished inflammasome activation and cell death by reducing the available ADAM10 on the cell surface. PMID: 27043625
  2. Staphylococcus aureus hemolysin A disrupts cell-matrix adhesions in human airway epithelial cells. PMID: 24918472
  3. Succeeded in preparing crystals of the heptameric form of alpha-hemolysin without any detergent but with 2-methyl-2,4-pentanediol (MPD), and determined its structure. PMID: 21280135
  4. Staphylococcus aureus alpha-hemolysin activates the NLRP3-inflammasome in human and mouse monocytic cells PMID: 19826485
  5. The wide vestibule leading into the alpha-hemolysin pore helps to orient negatively charged synthetic alpha-helical peptides for translocation. PMID: 16866363

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Aerolysin family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*