Recombinant Staphylococcus aureus Alpha-hemolysin (hly)

In Stock
Code CSB-EP639324FLFe1
Abbreviation Recombinant Staphylococcus aureus hly protein
MSDS
Size $554
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
hly
Uniprot No.
Research Area
Others
Alternative Names
hly; hla; SAOUHSC_01121Alpha-hemolysin; Alpha-HL; Alpha-toxin
Species
Staphylococcus aureus (strain NCTC 8325)
Source
E.coli
Expression Region
27-319aa
Target Protein Sequence
ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus aureus Alpha-hemolysin (hly) is produced in E. coli and covers the complete mature protein sequence from amino acids 27 to 319. SDS-PAGE analysis confirms this tag-free protein maintains purity levels above 85%. Researchers can rely on this preparation to study alpha-hemolysin properties, particularly its structural features and how it functions.

Alpha-hemolysin appears to be one of the most important components that Staphylococcus aureus produces. It's known for punching holes in host cell membranes. Being part of the toxin family, this protein helps the bacteria mess with cellular processes - which is why it has become such an interesting target for scientists trying to understand how bacteria cause disease and how they interact with their hosts. Research labs frequently work with this protein to figure out how it works and whether it might be a good target for new treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Staphylococcus aureus Alpha-hemolysin (hly) is expressed in E. coli. Alpha-hemolysin is a pore-forming toxin that must undergo precise folding and heptameric assembly to function. While E. coli can express bacterial proteins, the correct folding and oligomerization of this complex toxin are not guaranteed. The protein is expressed as the full-length mature protein (27-319aa), which is favorable, but its activity is unknown. Alpha-hemolysin requires specific conformational states for membrane binding and pore formation, which may not be achieved in E. coli without proper folding conditions. Therefore, without experimental validation (e.g., hemolytic activity assay), the protein cannot be assumed to be correctly folded or bioactive.

1. Protein-Protein Interaction Studies

This application is highly dependent on correct folding. If the alpha-hemolysin is misfolded, it may not interact authentically with host cell membrane proteins or receptors, leading to non-physiological binding partners or false negatives. The mature protein form is relevant, but results are only reliable if the protein is natively folded. This application should be avoided until functional validation (e.g., erythrocyte lysis assay) confirms bioactivity.

2. Antibody Development and Characterization

This application is generally suitable. The recombinant alpha-hemolysin can serve as an immunogen for antibody production, as antibodies may recognize linear epitopes independent of folding. The mature protein sequence ensures coverage of epitopes present in natural infections. However, if the protein is misfolded, antibodies may not recognize the native, functional toxin. Antibodies should be validated against active toxin or native bacterial samples.

3. Biochemical and Biophysical Characterization

This application is appropriate and should be prioritized to assess folding. Techniques like circular dichroism, size exclusion chromatography, and dynamic light scattering can directly evaluate secondary structure, oligomeric state, and aggregation. These studies are valuable even if the protein is misfolded, as they provide critical data on the recombinant product.

4. In Vitro Membrane Binding Studies

This application is critically dependent on correct folding and bioactivity. Alpha-hemolysin's membrane binding specificity relies on its native conformation. If misfolded, liposome binding experiments will not reflect physiological interactions, leading to misleading data on lipid preferences or binding kinetics. This application should only be pursued after confirming the protein's hemolytic activity and oligomerization capability.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, the priority is to validate the protein's function before most applications. Recommend first performing a hemolytic activity assay (e.g., using erythrocytes) to confirm pore-forming capability, followed by biophysical characterization (e.g., size-exclusion chromatography to check for heptamer formation). If active, the protein can be used for membrane binding and interaction studies; if inactive, focus on antibody development or as a control for biochemical analyses. Always include positive controls (e.g., native alpha-hemolysin) for functional assays, and consider optimizing expression conditions if folding issues are detected.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Alpha-toxin binds to the membrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Inhibits host neutrophil chemotaxis to the lesion region (Probable). Heptamer oligomerization and pore formation is required for lytic activity.
Gene References into Functions
  1. We now show that ADAM10 is critical for alpha-hemolysin-mediated activation of the NLRP3 inflammasome in human monocytes as siRNA knockdown or chemical blockade of ADAM10-alpha-hemolysin interaction leads to diminished inflammasome activation and cell death by reducing the available ADAM10 on the cell surface. PMID: 27043625
  2. Staphylococcus aureus hemolysin A disrupts cell-matrix adhesions in human airway epithelial cells. PMID: 24918472
  3. Succeeded in preparing crystals of the heptameric form of alpha-hemolysin without any detergent but with 2-methyl-2,4-pentanediol (MPD), and determined its structure. PMID: 21280135
  4. Staphylococcus aureus alpha-hemolysin activates the NLRP3-inflammasome in human and mouse monocytic cells PMID: 19826485
  5. The wide vestibule leading into the alpha-hemolysin pore helps to orient negatively charged synthetic alpha-helical peptides for translocation. PMID: 16866363

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Aerolysin family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*