Recombinant human Aspartate aminotransferase, mitochondrial protein

Code CSB-YP030644h
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP030644h
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP030644h-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP030644h
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP030644h
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
GOT2
Uniprot No.
Research Area
Transport
Alternative Names
AATM_HUMAN; AL022787; Aspartate aminotransferase 2; Aspartate aminotransferase; Aspartate aminotransferase; mitochondrial; Aspartate transaminase 2; ASPATA; EC 2.6.1.1; FABP 1; FABP pm; FABP-1; FABPpm; Fatty acid binding protein; Fatty acid-binding protein; FLJ40994; Glutamate oxaloacetate transaminase 2; Glutamate oxaloacetate transaminase 2; mitochondrial; Glutamate oxaloacetate transaminase; mitochondrial; Glutamic oxaloacetic transaminase 2; mitochondrial (aspartate aminotransferase 2); Got 2; GOT2; KAT4; KATIV; kynurenine aminotransferase 4; Kynurenine aminotransferase IV; kynurenine--oxoglutarate transaminase 4; kynurenine--oxoglutarate transaminase IV; mAspAT; MGC102129; MGC115763; mitAAT; mitochondrial; Mitochondrial aspartate aminotransferase; OTTMUSP00000017748; Plasma membrane fatty acid binding protein; Plasma membrane-associated fatty acid-binding protein; Transaminase A
Species
Homo sapiens (Human)
Expression Region
33-279aa
Target Protein Sequence
WTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAK
Mol. Weight
54.8kD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). As a member of the malate-aspartate shuttle, it has a key role in the intracellular NAD(H) redox balance. Is important for metabolite exchange between mitochondria and cytosol, and for amino acid metabolism. Facilitates cellular uptake of long-chain free fatty acids.
Gene References into Functions
  1. Study utilizing integrative analysis of transcriptomic, metabolomic, and clinical data propose a model of GOT2 transcriptional regulation, in which the cooperative phosphorylation of STAT3 and direct joint binding of STAT3 and p65/NF-kappaB to the proximal GOT2 promoter are important. Furthermore, high aberrant GOT2 expression is prognostic in diffuse large B-cell lymphoma. PMID: 29666362
  2. The results of our study on this larger than 5800-patient cohort suggest beneficial effects of high B12 vitamin level, negative effects of high sodium levels or high AST (aspartate aminotransferase) liver enzyme levels to cognition. PMID: 28918286
  3. Like in adults, FABP seems to be associated with markers of metabolic risk in obese adolescents PMID: 28183455
  4. Data suggest that, in context of abnormal hepatic lipid accumulation in nonalcoholic fatty liver disease, circulating GOT2 rises due to up-regulation of hepatic expression of GOT2 associated with greater gluconeogenesis and insulin resistance. PMID: 26791191
  5. A previously unknown mechanism by which GOT2 acetylation stimulates the malate-aspartate NADH shuttle activity and oxidative protection. PMID: 25755250
  6. High glucose infusion was associated with increased expression of higher plasma membrane-associated fatty acid-binding protein (FABPpm). PMID: 24937540
  7. The lipid binding process in L-FABP is associated with backbone dynamics. PMID: 22713574
  8. Frequency of polymorphism are similar in control groups and schizophrenics. PMID: 17728674

Show More

Hide All

Subcellular Location
Mitochondrion matrix. Cell membrane.
Protein Families
Class-I pyridoxal-phosphate-dependent aminotransferase family
Database Links

HGNC: 4433

OMIM: 138150

KEGG: hsa:2806

STRING: 9606.ENSP00000245206

UniGene: Hs.599470

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×