Recombinant human PCNA-associated factor

Code CSB-YP012164HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP012164HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP012164HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP012164HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
HCV NS5A transactivated protein 9 ; HCV NS5A-transactivated protein 9; Hepatitis C virus NS5A transactivated protein 9; Hepatitis C virus NS5A-transactivated protein 9; KIAA0101; L5; NS5 ATP9; NS5ATP9; OEATC 1; OEATC; OEATC-1; OEATC1; Overexpressed in anaplastic thyroid carcinoma 1; p15(PAF); p15PAF; PAF; PAF_HUMAN; PCNA associated factor; PCNA-associated factor
Species
Homo sapiens (Human)
Expression Region
1-111aa
Target Protein Sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Mol. Weight
39.4kD
Protein Length
Full length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
Gene References into Functions
  1. These results suggested that KIAA0101 knockdown suppressed the cell proliferation and cell cycle progression by promoting the formation of p53/Sp1 complex in breast cancer. PMID: 29902451
  2. PAF supports glioma stem cells maintenance, in part, by influencing DNA replication and pyrimidine metabolism pathways.PAF-associated DNA translesion synthesis activity influences glioma stem cell radiation resistance. PMID: 29073105
  3. KIAA0101 tv2 exerts anti-tumor activity in HCC and acts as an endogenous competitor of tumor-associated KIAA0101 tv1. KIAA0101 tv2 has a potential to work as a therapeutic drug targeting the KIAA0101 tv1 in HCC. PMID: 28410205
  4. Paf15 expression is associated with increased rectal cancer proliferation, decreased patient survival, and a worse radiotherapeutic response PMID: 27246972
  5. High KIAA0101 expression is associated with kidney cancer. PMID: 26575329
  6. The complex between p15PAF and trimeric PCNA is of low affinity, forming a transient complex that is difficult to characterize at a structural level due to its inherent polydispersity. We have determined the structure, conformational fluctuations, and relative population of the five species that coexist in solution by combining small-angle X-ray scattering (SAXS) with molecular modelling. PMID: 28180305
  7. miR-429 mediates deregulation of KIAA0101 by acting as an anti-metastatic miRNA that targets KIAA0101 pro-metastatic gene during metastasis of soft tissue sarcomas PMID: 28432002
  8. PAF stimulation dose-dependently promoted the invasion, migration and growth of prostate cancer cells in vitro, while knockdow our findings demonstrate that PAFR can activate ERK1/2 pathway, and subsequently increase MMP-3 expression and decrease E-cadherin expression PMID: 27176648
  9. High KIAA0101 level is associated with metastasis in hepatocellular carcinoma. PMID: 26968109
  10. Results unveil an unsuspected role of the PAF-Wnt signalling axis in modulating cell plasticity, which is required for the maintenance of breast cancer cell stemness. PMID: 26843124
  11. IN PATIENTS WITH HEPATITIS C VIRUS GENOTYPE 1B, TREATMENT RESPONSE WITH DACLATASVIR PLUS ASUNAPREVIR WITHOUT NS5A-L31F/I/M/V and/or NS5A-Y93H polymorphisms PMID: 26155891
  12. p15PAF acts as a flexible drag that regulates PCNA sliding along the DNA and facilitates the switch from replicative to translesion synthesis polymerase binding. PMID: 25762514
  13. Data show that hepatitis C virus NS5A-transactivated protein 9 (NS5ATP9) knockdown activated mitogen-activated protein kinase kinase/extracellular signal regulated kinases 1/2 signaling under C virus nonstructural protein 5A (NS5A) expression. PMID: 23698777
  14. NS5ATP9 mRNA overexpression in peripheral blood mononuclear cells was significantly associated with poor disease-free survival and overall survival of gastric cancer patients, but not with tumor recurrence. PMID: 24996800
  15. These results highlight an important potential role for NS5ATP9 in hepatitis C virus NS5A-induced hepatocyte autophagy. PMID: 24750205
  16. overexpression of KIAA0101 mRNA in peripheral blood mononuclear cells could act as a predictive biomarker for hepatic cancer PMID: 24197986
  17. Upregulated expression of KIAA0101 is associated with esophageal cancer progression, resistance to chemotherapy, and poor survival. PMID: 24145239
  18. Data indicate that PAF-EZH2-beta-catenin complex hyperactivates Wnt signaling. PMID: 24055345
  19. p15(PAF) is tightly regulated by the Rb/E2F complex. Loss of Rb/E2F-mediated repression during the G1/S transition phase leads to p15(PAF) upregulation, which facilitates DNA synthesis and S-phase progression. PMID: 23593430
  20. Low expression of PAF and high expression of TNF-alpha in leukocytospermia affect the sperm motility, which is one of the reasons that leads to infertility. PMID: 23209346
  21. GC patients with elevated KIAA0101 expression levels exhibited a high recurrence and subsequently poor prognosis in the survival study PMID: 23240630
  22. Down-regulation of KIAA0101 expression leads to an inhibition of cell proliferation, cell cycle and cell invasion of gastric carcinoma. PMID: 23157749
  23. KIAA0101 transcript variant 1 may function as a regulator, promoting cell survival in hepatocellular carcinoma through regulating the function of p53. PMID: 22576474
  24. The results uncovered a critical role for PCNA-associated factor PAF15 (p15(PAF)/KIAA0101) ubiquitylation during DNA replication. During unperturbed S phase, chromatin-associated PAF15 is modified by double mono-ubiquitylation of lysine 15 and 24. PMID: 23000965
  25. High-level KIAA0101 expression was observed in 33.9% (121 of 357 cases). PMID: 21689861
  26. Data supports that KIAA0101 is a marker of cellular proliferation, promotes growth and invasion, and is a good diagnostic marker for distinguishing benign from malignant adrenocortical neoplasm. PMID: 22096502
  27. This study identifies KIAA0101 as a protein important for breast tumorigenesis, and as this factor has been reported as a UV repair factor, it may link the UV damage response to centrosome control PMID: 21673012
  28. Data indicate that PAF15 associates with PCNA, and depletion of PAF15 decreases the number of cells in S phase, suggesting a role for it in cell cycle regulation. PMID: 21628590
  29. KIAA0101 gene may participate in cell cycle regulation of non-small cell lung cancer. PMID: 20118010
  30. Overexpression of KIAA0101 is associated with anaplastic thyroid carcinoma PMID: 15789362
  31. KIAA0101 protein expression was down-regulated in hepatocellular carcinoma; this gene could inhibit the HCC cell growth in vitro and presumably by its blocking effect on cell cycle PMID: 16646990
  32. NS5ATP9 is a NS5A up-regulation gene which may play a role in the pathogenesis of HCV-associated hepatocellular carcinoma. PMID: 18068894
  33. p15(PAF) gene is regulated by NF-kappa B signal transduction. PMID: 18727915
  34. Interaction between p15(PAF)and Proliferating Cell Nuclear Antigen is required for the DNA repair process. PMID: 19219066
  35. The PCNA-associated factor KIAA0101/p15(PAF) binds the potential tumor suppressor product p33ING1b. PMID: 16288740

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm, perinuclear region. Note=Following DNA damage, localizes to DNA damage sites (PubMed:21628590). Colocalizes with centrosomes in perinuclear region (PubMed:21673012).
Tissue Specificity
Expressed predominantly in liver, pancreas and placenta. Not detected in heart or brain. Highly expressed in a number of tumors, especially esophageal tumors, in anaplastic thyroid carcinomas, adrenocortical carcinomas, and in non-small-cell lung cancer l
Database Links

HGNC: 28961

OMIM: 610696

KEGG: hsa:9768

STRING: 9606.ENSP00000300035

UniGene: Hs.81892

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1