Recombinant Bovine Tumor necrosis factor receptor superfamily member 1A(TNFRSF1A)

Code CSB-CF023977BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O19131
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence VYPAGVQGLVPHPGDLEKRESPCPQGKYNHPQNSTICCTKCHKGTYLYNDCPGPGRDTDCRVCAPGTYTALENHLRRCLSCSRCRDEMFQVEISPCVVDRDTVCGCRKNQYREYWGETGFRCLNCSLCPNGTVNIPCQERQDTICHCHMGFFLKGAKCISCHDCKNKECEKLCPTRPSTGKDSQDPGTTVLLPLVIVFGLCLASFASVVLACRYQRWKPKLYSIICGQSTLVKEGEPELLVPAPGFNPTTTICFSSTPSSSPVSIPPYISCDRSNFGAVASPSSETAPPHLKAGPILPGPPASTHLCTPGPPASTHLCTPGPPASTHLCTPVQKWEASAPSAPDQLADADPATLYAVVDGVPPSRWKELVRRLGLSEHEIERLELENGRHLREAQYSMLAAWRRRTPRREATLELLGRVLRDMDLLGCLENIEEALGGAARLASEPRLLW
Source in vitro E.coli expression system
Gene Names TNFRSF1A
Protein Names Recommended name: Tumor necrosis factor receptor superfamily member 1A Alternative name(s): Tumor necrosis factor receptor 1 Short name= TNF-R1 Tumor necrosis factor receptor type I Short name= TNF-RI Short name= TNFR-I p55 p60 CD_ant
Expression Region 22-471
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis (By similarity).
Subcellular Location Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein
Database Links

KEGG: bta:282527

STRING: 9913.ENSBTAP00000005522

UniGene: Bt.3890

Pathway MAPK signaling pathway
mTOR signaling pathway
NF-kappa B signaling pathway
TNF signaling pathway
Apoptosis
Necroptosis
Osteoclast differentiation
Adipocytokine signaling pathway

Related Products

TNFRSF1A Proteins

TNFRSF1A Proteins for Bos taurus (Bovine)

TNFRSF1A ELISA Kit

TNFRSF1A ELISA Kit for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.