Recombinant Chicken Frizzled-7(FZD7)

Code CSB-CF009110CH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O57329
Storage Buffer Tris-based buffer,50% glycerol
Species Gallus gallus (Chicken)
Sequence AHHEDKAISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDAPPGPGGAGGRGATAQPTAGYLPDLLTPPQPAAGFSFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRPNGLMYFKEAEVRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYAAGFLLEERVVCLERFSEDGYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGIYSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVVACYFYEQAFRSTWEKTWLLQTCKTYAVPCPSHFAPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSTGSKGETAV
Source in vitro E.coli expression system
Gene Names FZD7
Protein Names Recommended name: Frizzled-7 Short name= Fz-7 Short name= cFz-7
Expression Region 32-567
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.
Subcellular Location Cell membrane, Multi-pass membrane protein, Endosome membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor Fz/Smo family
Tissue Specificity Expressed broadly in cranial ectoderm. Also expressed in the developing somites and in other cranial placodes, including the olfactory, lens, otic placodes (lateral half of the vesicle) and epibranchial placodes. Low level of expression in all the mesoder
Database Links

KEGG: gga:374060

STRING: 9031.ENSGALP00000030969

UniGene: Gga.110

Pathway Hippo signaling pathway
Melanogenesis
mTOR signaling pathway
Wnt signaling pathway
Signaling pathways regulating pluripotency of stem cells

Related Products

FZD7 Proteins

FZD7 Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.