Recombinant Danio rerio C5a anaphylatoxin chemotactic receptor(c5ar1)

Code CSB-CF003996DIL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0C7U5
Storage Buffer Tris-based buffer,50% glycerol
Species Danio rerio (Zebrafish) (Brachydanio rerio)
Sequence MDDNNSDWTSYDFGNDTIPSPNEISLSHIGTRHWITLVCYGIVFLLGVPGNALVVWVTGF RMPNSVNAQWFLNLAIADLLCCLSLPILMVPLAQDQHWPFGALACKLFSGIFYMMMYCSV LLLVVISLDRFLLVTKPVWCQNNRQPRQARILCFIIWILGLLGSSPYFAHMEIQHHSETK TVCTGSYSSLGHAWAITIIRSFLFFLLPFLIICISHWKVYHMTSSGRRQRDKSSRTLRVI LALVLGFFLCWTPLHIVDLLILVSDQPSERFEVNLNLAHVLTLCLAYINSCLNPLLYVCL GRGFKENLISSLRSVLHFASEAPTHGPSMTTNSKSTTDGVFREKPV
Source in vitro E.coli expression system
Gene Names c5ar1
Protein Names Recommended name: C5a anaphylatoxin chemotactic receptor Short name= C5a-R Short name= C5aR
Expression Region 1-346
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: dre:100000959

STRING: 7955.ENSDARP00000059000

Pathway Complement and coagulation cascades

Related Products

c5ar1 Antibodies

c5ar1 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

c5ar1 Proteins

c5ar1 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.