Recombinant Dog Adenosine receptor A2a(ADORA2A)

Code CSB-CF001376DO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P11617
Storage Buffer Tris-based buffer,50% glycerol
Species Canis lupus familiaris (Dog) (Canis familiaris)
Sequence MSTMGSWVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI PFAITISTGFCAACHNCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR AKGIIAVCWVLSFAIGLTPMLGWNNCSQPKEGRNYSQGCGEGQVACLFEDVVPMNYMVYY NFFAFVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG LFALCWLPLHIINCFTFFCPECSHAPLWLMYLTIVLSHTNSVVNPFIYAYRIREFRQTFR KIIRSHVLRRREPFKAGGTSARALAAHGSDGEQISLRLNGHPPGVWANGSAPHPERRPNG YTLGLVSGGIAPESHGDMGLPDVELLSHELKGACPESPGLEGPLAQDGAGVS
Source in vitro E.coli expression system
Gene Names ADORA2A
Protein Names Recommended name: Adenosine receptor A2a
Expression Region 1-412
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: cfa:403960

STRING: 9615.ENSCAFP00000020374

UniGene: Cfa.3818

Pathway Calcium signaling pathway
cAMP signaling pathway
Vascular smooth muscle contraction
Rap1 signaling pathway

Related Products

ADORA2A Proteins

ADORA2A Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.