Recombinant Dog B-lymphocyte antigen CD20(MS4A1)

Code CSB-CF661636DO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q3C2E2
Storage Buffer Tris-based buffer,50% glycerol
Species Canis lupus familiaris (Dog) (Canis familiaris)
Sequence MTTPRNSMSGTLPVDPMKSPTAMYPVQKIIPKRMPSVVGPTQNFFMRESKTLGAVQIMNG LFHIALGSLLMIHTDVCAPICITMWYPLWGGIMFIISGSLLAAADKNPRKSLVKGKMIMN SLSLFAAISGIIFLIMDIFNITISHFFKMENLNLIKAPMPYVDIHNCDPANPSEKNSLSI QYCGSIRSVFLGVFAVMLIFAFFQKLVTAGIVENEWKKLCSKPKSDVVVLLAAEEKKEQP IETTEEMVELTEIASQPKKEEDIEIIPVQEEEGELEINFAEPPQEQESSPIENDSIP
Source in vitro E.coli expression system
Gene Names MS4A1
Protein Names Recommended name: B-lymphocyte antigen CD20 Alternative name(s): Membrane-spanning 4-domains subfamily A member 1 CD_antigen= CD20
Expression Region 1-297
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This protein may be involved in the regulation of B-cell activation and proliferation.
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor
Protein Families MS4A family
Tissue Specificity Expressed in PBMCs and lymph node from healthy dogs, in B-cells of canine lymphoma, but not in T-cell lymphoma cells and non-T and non-B-cell lymphoma cells.
Database Links

KEGG: cfa:485430

STRING: 9615.ENSCAFP00000035044

UniGene: Cfa.23836

Pathway Hematopoietic cell lineage

Related Products

MS4A1 Proteins

MS4A1 Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.