Code | CSB-CF676611DO |
Size | Pls inquire other sizes |
Source | in vitro E.coli expression system |
Target Names | SSTR2 |
Uniprot No. | Q49LX6 |
Species | Canis lupus familiaris (Dog) (Canis familiaris) |
Expression Region | 1-369 |
Target Protein Sequence | MDMEYELLNESHTWVSPPFDLDGSVVAANSSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG NTLVIYVILRYAKMKTITNIYILNLAIAGELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMVNVAVWGVSLLVVLPIMIY AGLRSNQWGRSSCTINWPGESGTWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDLVVVL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGPDDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI |
Protein Length | full length protein |
Tag Info | The following tags are available. N-terminal 10xHis-tagged The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
|
Form | Lyophilized powder |
Buffer before Lyophilization | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet | Please contact us to get it. |
Still Have Questions? | Start a Chat |
Function | Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as sensitive G proteins. Inhibits calcium entry by suppressing voltage-dependent calcium channels. Acts as the functionally dominant somatostatin receptor in pancreatic alpha- and beta-cells where it mediates the inhibitory effect of somatostatin-14 on hormone secretion. Inhibits cell growth through enhancement of MAPK1 and MAPK2 phosphorylation and subsequent up-regulation of CDKN1B. Stimulates neuronal migration and axon outgrowth and may participate in neuron development and maturation during brain development. Mediates negative regulation of insulin receptor signaling through PTPN6. Inactivates SSTR3 receptor function following heterodimerization (By similarity). |
Subcellular Location | Cell membrane, Multi-pass membrane protein, Cytoplasm |
Protein Families | G-protein coupled receptor 1 family |
Database Links |
KEGG: cfa:403472 STRING: 9615.ENSCAFP00000006717 UniGene: Cfa.186 |
Recombinant Sheep Interleukin-12 subunit beta(IL12B)
Express system: E.coli
Species: Ovis aries (Sheep)
Recombinant Human Bone sialoprotein 2 (IBSP),Partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Heat shock protein HSP 90-beta(HSP90AB1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Immunoglobulin J chain(JCHAIN)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Programmed cell death protein 5(PDCD5)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human DNA fragmentation factor subunit alpha(DFFA)
Express system: E.coli
Species: Homo sapiens (Human)