Recombinant Human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3)

Discontinued
Code CSB-CF618642HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
BNIP3; NIP3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Species
Homo sapiens (Human)
Expression Region
1-194
Target Protein Sequence
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSK SSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDW SSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLG IYIGRRLTTSTSTF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. Plays an important role in the calprotectin (S100A8/A9)-induced cell death pathway.
Gene References into Functions
  1. BNIP3 was mainly localized in the cytoplasm, and high expression of BNIP3 accounted for 31.9% (15/47) of the uveal melanoma patients in our study. High expression of BNIP3 was demonstrated to be significantly associated with more pigment (P=0.018) and deeper scleral invasion (P=0.013). PMID: 29982263
  2. lncRNA HULC up-regulated BNIP3. PMID: 29803927
  3. TUG1 overexpression aggravates hypoxia injury of cardiomyocytes by regulating miR-145-5p-Bnip3 axis to activate Wnt/beta-catenin pathways. PMID: 29207102
  4. In ESCC cells, although BNIP3-induced autophagy is protective, BNIP3 exerts a pro-death function under hypoxia. PMID: 28859361
  5. Silencing of BNIP3 suppressed free fatty acid synthesis in mesenchymal stem cells. BNIP3 induction by hypoxia stimulates FASN-dependent free fatty acid production. PMID: 28704726
  6. Apoptosis, but not autophagy, that is induced via p21-activated BNIP3 expression accounts for the efficacy of ICMT inhibition in sensitive pancreatic cancer cells in both in vitro and in vivo models. In contrast, cells resistant to ICMT inhibition demonstrated no mitochondria dysfunction or p21 signaling changes under ICMT suppression PMID: 28167504
  7. BNIP3 is a significant contributor to the pathogenesis of inflammation-induced heart failure pathologies [review] PMID: 27112557
  8. The authors find that KDM3A promotes anoikis through transcriptional activation of BNIP3 and BNIP3L, which encode pro-apoptotic proteins. PMID: 27472901
  9. BNIP3-induced autophagy. PMID: 28151469
  10. the results suggest that BNIP3 plays a vital role in regulating PINK1 mitochondrial outer membrane localization, the proteolytic process of PINK1 and PINK1/parkin-mediated mitophagy under physiological conditions. PMID: 27528605
  11. High BNIP3 expression is associated with chronic myelogenous leukemia. PMID: 27592257
  12. Results suggest that changes in mitochondrial morphology and transmembrane potential, induced by mutant htt protein, are dependent and linked to BNip3 and not to Bax/Bak activation. PMID: 26358776
  13. Hypoxia-induced autophagy contributes to the invasion of salivary adenoid cystic carcinoma through the HIF-1alpha/BNIP3 signaling pathway. PMID: 26323347
  14. The data indicated that BNIP3 plays a vital role in the tumorigenesis of adenoid cystic carcinoma and could be a new target for gene therapy of adenoid cystic carcinoma. PMID: 25769455
  15. BNIP3 deletion can be used as a prognostic marker of tumor progression to metastasis in human triple-negative breast cancer PMID: 26232272
  16. BNIP3 expression was found to be regulated by Sp3 in prostate cancer. PMID: 26012884
  17. phosphorylation of these C-terminal BNIP3 residues blocks cell death without preventing autophagy, providing evidence that the two functional roles of BNIP3 can be regulated independently PMID: 26102349
  18. Bnip3 dual-functionality and crosstalk between mitophagy and apoptosis pathways is presented here. PMID: 26253153
  19. these findings revealed that silibinin induced autophagic cell death through ROS-dependent mitochondrial dysfunction and ATP depletion involving BNIP3 in MCF7 cells. PMID: 25891311
  20. The findings of the present study reveal a novel survival pathway that functionally couples the unique glycolytic phenotype in cancer cells to hypoxia resistance via a PDK2-dependent mechanism that switches Bnip3 from cell death to survival. PMID: 26416963
  21. Mevalonate depletion through HMG-CoA reductase inhibition impairs the viability of primary human mesenchymal stells via NF-kappaB/Bnip3 signaling. PMID: 25547946
  22. protective role of BNIP3 in the form of autophagy inducer to reduce the misfolded proteins directly and prevention of neurodegenerative diseases indirectly PMID: 24928088
  23. our results bring the evidence of a mechanism that links apoptosis and ROS-induced BNIP3 expression in MG-63 cells with bacalein treatment and suggest that baicalein has a good potential as an anti-osteosarcoma drug. PMID: 25618603
  24. Results show that BNIP3 interacts with the voltage-dependent anion channel (VDAC) to directly induce mitochondrial release and nuclear translocation of EndoG. PMID: 25436615
  25. AT101 caused caspase-independent, non-apoptotic malignant peripheral nerve sheath tumor cell death, which was accompanied by autophagy and was mediated through HIF-1alpha induced expression of the atypical BH3-only protein BNIP3. PMID: 24824755
  26. BNIP3 shows low levels of promoter hypermethylation in invasive breast cancer, mostly lower than the proposed 15% threshold that supposedly discriminates "true" from background methylation. PMID: 20978322
  27. Low BNIP3 expression is associated with renal cancer. PMID: 23851496
  28. BNIP3 has a protective effect against UVB-induced apoptosis in keratinocytes PMID: 24402046
  29. the impact of Glutamate carboxypeptidase II (GCPII) haplotypes on the expression of PSMA, BNIP3, Ec-SOD, GSTP1 and RASSF1 genes were elucidated to understand the epigenetic basis of oxidative stress and prostate cancer risk. PMID: 23979608
  30. The upregulation of miR-210 directly suppresses BNIP3 expression to maintain the survival of NPCs under hypoxia. PMID: 23688833
  31. This paper aims to summarize the existing body of knowledge related to the role of BNIP3 in autophagy, as well as the importance of this process in tumorigenesis. PMID: 23667095
  32. BNIP3 is initially silenced by methylation, but upon re-expression remains under predominant control of Ras and the related MEK/MAPK pathway (as presented in DLD-1 and HT-29 cells). PMID: 24211581
  33. our data show for the first time that glucose availability significantly affects the hypoxia-induced HIF-1/BNIP3 response, and in particular glucose absence results in enhancing the oxidative phosphorylation rate. PMID: 23538299
  34. Both expression level and activity of DNMT1 were inversely correlated with the expression level of BNIP3 in colon carcinoma cells after treatment with chemotherapeutic agents and radiation PMID: 23364257
  35. ULK1-dependent autophagy degrades BNIP3 via MTORC1 and AMPK PMID: 23291726
  36. The accelerated autophagic status in non-small cell lung carcinoma is unrelated to Beclin 1 and BNIP3 expression, but does show significant association with Bcl-2 reactivity. PMID: 23216071
  37. results suggest aberrations in one-carbon metabolism appear to induce altered gene expression of EC-SOD, GSTP1, and BNIP3, and thus contribute to the increased oxidative stress and increased susceptibility to coronary artery disease PMID: 23160801
  38. pro-survival Bcl-x(L) positively regulated Bnip3 binding to LC3B, sequestration, and mitochondrial autophagy, further supporting an anti-apoptotic role for Bnip3-induced mitophagy PMID: 23209295
  39. BNIP3 expression induced autophagosome accumulation with lysosome consumption in cardiomyocytes. PMID: 22302006
  40. BNIP3 expression and TGM2 expression are independent prognostic factors in laryngeal SCC patients receiving postoperative radiotherapy. PMID: 22458929
  41. Bnip3 induced removal of both ER (ERphagy) and mitochondria (mitophagy) via autophagy. The clearance of these organelles was mediated in part via binding of Bnip3 to LC3 on the autophagosome. PMID: 22505714
  42. The expression of both HIF-1alpha and VEGF were not significantly increased in BNIP3 positive clear cell renal cell carcinoma in comparison with BNIP3 negative tumors. PMID: 22455137
  43. The physical interaction of Mieap, BNIP3 and NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. PMID: 22292033
  44. The detection of genes selectively methylated in high-grade Intraductal papillary mucinous neoplasms (IPMNs) such as BNIP3 may have use in the clinical evaluation of IPMNs PMID: 22173550
  45. MTRR A66G and cSHMT C1420T polymorphisms influence CpG island methylator phenotype of BNIP3, thus epigenetically regulating BNIP3 in breast cancer PMID: 21987236
  46. The BNIP3 promoter is methylated in both human hepatoma and colon carcinoma cells and tumor specimens. PMID: 21911457
  47. proapoptotic regulator Bcl2/adenovirus EIB 19 kDa-interacting protein 3 has an effect on radiosensitivity of cervical cancer PMID: 21711117
  48. Hypermethylation of BNIP3 gene is associated with advanced gastric cancer. PMID: 21409489
  49. p53 suppressed BNIP3 expression by directly binding to the p53-response element motif and recruiting corepressor mSin3a to the BNIP3 promoter. PMID: 21792176
  50. DNA methylation of the BNIP3 promoter is responsible for the inhibition of BNIP3 induction PMID: 21573703

Show More

Hide All

Subcellular Location
Mitochondrion. Mitochondrion outer membrane; Single-pass membrane protein. Note=Coexpression with the EIB 19-kDa protein results in a shift in NIP3 localization pattern to the nuclear envelope. Colocalizes with ACAA2 in the mitochondria. Colocalizes with SPATA18 at the mitochondrion outer membrane.
Protein Families
NIP3 family
Database Links

HGNC: 1084

OMIM: 603293

KEGG: hsa:664

STRING: 9606.ENSP00000357625

UniGene: Hs.144873

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1