Recombinant Human Claudin-9(CLDN9)

Code CSB-CF005511HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
CLDN9
Uniprot No.
Alternative Names
CLDN9; Claudin-9
Species
Homo sapiens (Human)
Expression Region
1-217
Target Protein Sequence
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG QMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT AGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL LCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Protein Length
Full length protein
Tag Info
The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells.
Gene References into Functions
  1. CLDN9 may be an important biomarker for invasive pituitary oncocytomas. PMID: 25281028
  2. Claudins 6, 7, and 9 expressions are closely related to gastric carcinogenesis. PMID: 19960275
  3. Mouse studies suggest that claudin-9 deficiency may cause hearing loss not only in mice but also in humans. PMID: 19696885
  4. Residues N38 and V45 in the first extracellular loop (EL1) of CLDN9 are necessary for HCV entry. PMID: 17804490
  5. CLDN9, clustered with CLDN6 at human chromosome 16p13.3, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. PMID: 12736707

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.
Database Links

HGNC: 2051

OMIM: 615799

KEGG: hsa:9080

STRING: 9606.ENSP00000398017

UniGene: Hs.296949

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St Ste 610-322 Houston, TX 77054, USA
Join Us with

Leave a message

check code
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1