Recombinant Human Cyclic AMP-responsive element-binding protein 3 (CREB3)

Code CSB-CF005948HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CREB3; LZIP; Cyclic AMP-responsive element-binding protein 3; CREB-3; cAMP-responsive element-binding protein 3; Leucine zipper protein; Luman; Transcription factor LZIP-alpha
Species
Homo sapiens (Human)
Expression Region
1-371
Target Protein Sequence
MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endoplasmic reticulum (ER)-bound sequence-specific transcription factor that directly binds DNA and activates transcription. Plays a role in the unfolded protein response (UPR), promoting cell survival versus ER stress-induced apoptotic cell death. Also involved in cell proliferation, migration and differentiation, tumor suppression and inflammatory gene expression. Acts as a positive regulator of LKN-1/CCL15-induced chemotaxis signaling of leukocyte cell migration. Associates with chromatin to the HERPUD1 promoter. Also induces transcriptional activation of chemokine receptors.; This is the transcriptionally active form that translocates to the nucleus and activates unfolded protein response (UPR) target genes during endoplasmic reticulum (ER) stress response. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGTFunctions as a negative transcriptional regulator in ligand-induced transcriptional activation of the glucocorticoid receptor NR3C1 by recruiting and activating histone deacetylases (HDAC1, HDAC2 and HDAC6). Also decreases the acetylation level of histone H4. Does not promote the chemotactic activity of leukocyte cells.; (Microbial infection) Plays a role in human immunodeficiency virus type 1 (HIV-1) virus protein expression.; (Microbial infection) Plays a role in herpes simplex virus-1 (HSV-1) latent infection and reactivation from latency. Represses the VP16-mediated transactivation of immediate early genes of the HSV-1 virus by sequestering host cell factor-1 HCFC1 in the ER membrane of sensory neurons, thereby preventing the initiation of the replicative cascade leading to latent infection.; (Microbial infection) May play a role as a cellular tumor suppressor that is targeted by the hepatitis C virus (HCV) core protein.; (Microbial infection) Activates transcription of genes required for reactivation of the latent HSV-1 virus. It's transcriptional activity is inhibited by CREBZF in a HCFC1-dependent manner, by the viral transactivator protein VP16. Binds DNA to the cAMP response element (CRE) (consensus: 5'-GTGACGT(Microbial infection) It's transcriptional activity is inhibited by CREBZF in a HCFC1-dependent manner, by the viral transactivator HCV core protein.
Gene References into Functions
  1. Luman, a ubiquitous, non-canonical unfolded protein response (UPR), is identified as a novel regulator of endoplasmic reticulum stress-induced PRNP expression. PMID: 28205568
  2. In summary, the authors show here that hepatitis C virus infection is associated with an upregulation of ARF4, which promotes hepatitis C virus replication. Upon hepatitis C virus infection, CREB3 was redistributed to nucleus and activated ARF4 transcription. PMID: 28840565
  3. sLZIP is a novel co-repressor of ERalpha, and plays a negative role in ERalpha-mediated cell proliferation in breast cancer PMID: 28662179
  4. These findings indicate that LZIP is a novel modulator of APOA4 expression and hepatic lipid metabolism. PMID: 28246167
  5. The authors found that the CREB3/Herp pathway limited the increase in cytosolic Ca2+ concentration and apoptosis early in poliovirus infection and this may reduce the extent of poliovirus-induced damage to the central nervous system during poliomyelitis. PMID: 27405867
  6. The essential parts of the Golgi stress response from the perspective of the organelle autoregulation. The pathways of the mammalian Golgi stress response have been identified, specifically the CREB3 pathway. PMID: 28179603
  7. These results indicate that sLZIP plays a role in expression of c-Jun, and migration and invasion of cervical cancer cells via regulation of MMP-9 transcription. PMID: 24481121
  8. INHA gene expression is upregulated by cAMP via CRE in human trophoblasts, and TFAP2 regulates this expression by interacting with CRE. PMID: 25358080
  9. Findings indicate that sLZIP negatively regulates AR transactivation in androgen-dependent PCa cells and functions as a positive regulator in tumor progression of androgen-independent PCa. sLZIP contributes to the malignant phenotype of PCa. PMID: 24441043
  10. human sLZIP plays a critical role in development of atherosclerosis and can be used as a therapeutic target molecule for treatment of atherosclerosis PMID: 25077563
  11. A CREB3-ARF4 signalling cascade may be part of a Golgi stress response set in motion by stimuli compromising Golgi capacity. PMID: 24185178
  12. propose that JAB1 is a novel binding partner of Luman, which negatively regulates the activity of Luman by promoting its degradation PMID: 23583719
  13. GSK3beta was downregulate in all samples and CREB3 did not show a significant decrease or increase in its mRNA expression, but the results were significant in mucoepidermoid carcinoma and salivary duct carcinoma. PMID: 23023215
  14. sLZIP plays a critical role in MMP-9 expression and is probably involved in invasion and metastasis of cervical cancer PMID: 22009750
  15. sLZIP-regulated ARF4 expression in response to phorbol 12-myristate 13-acetate is involved in breast cancer cell migration. PMID: 22004728
  16. These findings suggest that HDAC3 selectively represses CREB3-mediated transcriptional activation and chemotactic signalling in human metastatic breast cancer cells. PMID: 20473547
  17. DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. PMID: 20546900
  18. sLZIP functions as a negative regulator in glucocorticoid-induced transcriptional activation of GR by recruitment and activation of HDACs PMID: 19779205
  19. Data show that Luman is processed by regulated intramembrane proteolysis. The site 1 protease (S1P), a Golgi-resident enzyme, may be involved in the processing of Luman. PMID: 12138176
  20. HCF-1 contains an activation domain (HCF-1(AD)) required for maximal transactivation by VP16 and its cellular counterpart LZIP. PMID: 12271126
  21. LZIP binds to CCR1 and the interaction between CCR1 and LZIP participates in regulation of Lkn-1-dependent cell migration without affecting the chemotactic activities of other CC chemokines that bind to CCR1. PMID: 15001559
  22. the host cell factor-binding transcription factor Luman is inhibited by Zhangfei PMID: 15705566
  23. Results report the identification of Herp, a gene involved in ER stress-associated protein degradation (ERAD), as a direct target of Luman. PMID: 16940180
  24. LZIP functions as a positive regulator in the NF-kappaB activation pathway that is triggered by Lkn-1 without affecting the transcriptional activation of NF-kappaB induced by other CCR1-dependent chemokines PMID: 17192849
  25. factor NF-kappaB plays an important role in regulation of LZIP expression, and LZIP expression regulates the monocyte cell migration induced by Lkn-1 PMID: 17296613
  26. Luman/CREB3 recruitment factor inhibits Luman activation of the unfolded protein response PMID: 18391022

Show More

Hide All

Subcellular Location
[Isoform 1]: Endoplasmic reticulum membrane; Single-pass type II membrane protein. Golgi apparatus.; [Isoform 2]: Nucleus. Cytoplasm.; [Processed cyclic AMP-responsive element-binding protein 3]: Nucleus.; [Isoform 1]: Cytoplasm.
Protein Families
BZIP family, ATF subfamily
Tissue Specificity
Ubiquitously expressed. Expressed in dendritic cells (DC). Weakly expressed in monocytes (at protein level).
Database Links

HGNC: 2347

OMIM: 606443

KEGG: hsa:10488

UniGene: Hs.522110

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1