Recombinant Human Cytochrome c oxidase subunit 2 (MT-CO2)

Code CSB-CF015073HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MT-CO2
Uniprot No.
Alternative Names
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Species
Homo sapiens (Human)
Expression Region
1-227
Target Protein Sequence
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Gene References into Functions
  1. Study shows that higher COX-2 and ALOX5 expression in colorectal cancer (CRC) tissues was correlated with poorer prognosis in patients with CRC. Also, MiR-216a-3p was shown to directly bind to there 3'-UTR and inversely regulates their protein levels modulating CRC cell proliferation. PMID: 28786533
  2. Data suggest that mutations in MT-CO2 and MT-ND5 can be involved in MIDD (maternally inherited diabetes and deafness); a Tunisian family (mother, daughter, son) with clinical features of MIDD associated with retinopathy exhibit mutations in MT-CO2 (m.8241T>G - p. F219C) and MT-ND5 (m.13276G>A - p. M314V); these two mutations could explain retinopathy in some family members. (MT-ND5 = NADH dehydrogenase subunit 5) PMID: 27422531
  3. Results demonstrates that the presence of high levels of COX-2 is associated with poor prognosis for breast cancer patients and predicts bigger tumor size and lymph node metastasis. [metastasis] PMID: 27999206
  4. results demonstrated that XRCC5 promoted colon cancer growth by cooperating with p300 to regulate COX-2 expression, and suggested that the XRCC5/p300/COX-2 signaling pathway was a potential target in the treatment of colon cancers PMID: 29049411
  5. inhibitory effects of 17-AAG on PGE2 levels in HT-29 colorectal cancer cells were mediated through modulating COX-2 and 15-PGDH expression. PMID: 27075590
  6. The sequencing analysis revealed the presence of 17 variants, mostly causing non-synonymous changes in conserved amino acid residues, typically distributed in the MT-CO2 gene of MUTYH-associated polyposis patients (P < 0.0001), who frequently carried the hot spot m.7763G>A variant. PMID: 26138249
  7. Results find that COA6 associates with COX2 and is crucial for its maturation and complex IV biogenesis. Also, COA6 interacts with the copper chaperone SCO1 which indicates that COA6 is intrinsically involved in the copper delivery process for COX2. PMID: 26160915
  8. Mutational analysis show a novel MTCO2 mutation 8249G>A pathogenic variation in Tunisian patients with mitochondrial myopathy. PMID: 23841600
  9. We also detected in 4 asthenospermic patients a double novels mutations, the first was found in COXII gene (m.8021 G/A) that was absent in normospermic infertile men. PMID: 24931671
  10. The presence of a non-synonymous variation in the COII strongly correlated with poor survival in patients with cytogenetically normal acute myeloid leukemia. PMID: 23826975
  11. Protein modeling revealed loss of function mutations of ND6 and COX-II proteins in malignant vs benign tumors PMID: 24061460
  12. COX-2 expression played an essential role in the proliferation and metastasis of tongue cancer. PMID: 21069476
  13. Novel COII mutations responsible for maternally inherited nonsyndromic hearing loss PMID: 22241583
  14. The apoptotic index of pulmonary vascular endothelial cells was negatively correlated with COXII expression in patients with chronic obstructive pulmonary disease. PMID: 21092633
  15. This protein has been found differentially expressed in thalami from patients with schizophrenia. PMID: 20471030
  16. COX-II is induced in HIV infected apoptotic T-cells. PMID: 19771519
  17. Ageing muscle: clonal expansions of mitochondrial DNA point mutations and deletions cause focal impairment of mitochondrial function. PMID: 12031622
  18. the expression of mitochondria-encoded COXII is HRG-responsive. The levels of ErbB2 expression are decisive for the diverse biological activities of HRG. PMID: 12115729
  19. frequency of occurrence of mtDNA with the COII/tRNA(Lys) intergenic 9-bp deletion polymorphism in patients with myoclonic epilepsy with ragged-red fibers or mitochondrial encephalomyopathy syndrome is higher than that of healthy subjects PMID: 15965049
  20. Mutations in mtDNA-encoded cytochrome c oxidase subunit II genes causing isolated myopathy or severe encephalomyopathy. PMID: 16288875
  21. DNA hypermethylation of the COX-2 gene may be a potential prognostic marker in early stage cervical cancer. PMID: 17578348
  22. a fraction of Sco1 physically associates with the cytochrome c oxidase complex in human muscle mitochondria, suggesting a possible direct relationship between CcO and the regulation of cellular copper homeostasis PMID: 19295170
  23. SCO2 acts upstream of SCO1, and that it is indispensable for CO II synthesis. PMID: 19336478
  24. CoxII can be phosphorylated by EGFR and c-Src, and EGF stimulation reduces Cox activity and cellular ATP, an event that is dependent in large part on EGFR localized to the mitochondria. PMID: 19840943
  25. Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 12732844

Show More

Hide All

Involvement in disease
Mitochondrial complex IV deficiency (MT-C4D)
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Cytochrome c oxidase subunit 2 family
Database Links

HGNC: 7421

OMIM: 220110

KEGG: hsa:4513

STRING: 9606.ENSP00000354876

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1