Recombinant Human D (1B) dopamine receptor (DRD5)

Code CSB-CF007182HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
DRD5; DRD1B; DRD1L2; D(1B dopamine receptor; D(5 dopamine receptor; D1beta dopamine receptor; Dopamine D5 receptor
Species
Homo sapiens (Human)
Expression Region
1-477
Target Protein Sequence
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. Dopamine D5 receptor may play an important role in the preservation of normal heart function by inhibiting the production of reactive oxygen species, via inhibition of NADPH oxidase, Nrf2 degradation, and ERK1/2/JNK pathways. PMID: 30153650
  2. The C allele of DRD5 rs6283 SNP was associated with decreased risk of awake bruxism (p = 0.01). PMID: 28451935
  3. DRD5 (dopamine receptor D5) agonists were potent inhibitors of pituitary tumor growth. PMID: 28613975
  4. Meta-analysis of data from six sites of the International Multicentre persistent ADHD CollaboraTion tested the association of the common DRD5 alleles with categorically defined ADHD and with inattentive and hyperactive/impulsive symptom counts, found evidence that none of the common DRD5 alleles are associated with ADHD risk or ADHD symptom counts in adults. PMID: 27480019
  5. Study investigated the contribution of DRD5 gene variants in the symptoms of attention-deficit/hyperactivity disorder (ADHD): 19 exonic variants were monomorphic in the Indo-Caucasoid individuals. rs6283 "C" and rs113828117 "A" exhibited significant higher occurrence in families with ADHD probands. Early and late onset groups exhibited significantly different genotypic frequencies. PMID: 27250208
  6. This study reveled that DRD5 are up regulation in CD4+ T effector and regulatory cells in patient with multiple sclerosis. PMID: 27609280
  7. DRD5 gene expression reduction in breast cancer patients after spiritual intervention PMID: 26597879
  8. This study shown DRD5 to be the risk factor for attention deficit/hyperactivity disorder. PMID: 25840828
  9. This study demonistrated that Lymphocyte DR D5 is reduced in MS and IFN-beta restores their expression and responsiveness. PMID: 25468276
  10. Constitutive D5R signalling up-regulated expression of Na,K-ATPase-alpha2 and NHE-2, increasing glucose metabolism. Agonist treatment increased this and also upregulated NHE-3. PMID: 25154512
  11. Our find-ings suggest that common genetic variations of DRD5 are likely to con-tribute to genetic susceptibility to paranoid schizophrenia in Han Chinese PMID: 24668635
  12. confirmed at protein level the previously reported increased expression of DRD5 and the variably aberrant expression of ADORA2A, in Lesch-Nyhan disease lymphocytes PMID: 22403020
  13. SNX1 has a crucial role in D(5)R trafficking and SNX1 depletion results in D(5)R dysfunction and thus may represent a novel mechanism for the pathogenesis of essential hypertension PMID: 23152498
  14. Tests of a DRD5 microsatellite and four DRD5 single nucleotide polymorphism variants do not support a significant deviation from the Hardy-Weinberg equilibrium in either Caucasian or African American patients. PMID: 22203087
  15. For the first time we report a significant association between nicotine dependence and DRD5, NPY1R MAP3K4 single nucleotide polymorphism. PMID: 22309839
  16. intracellular loop 3 is the critical determinant underlying the subtype-specific regulation of human D5-dopaminergic receptor responsiveness by protein kinase C PMID: 21893192
  17. Data show that the D5 receptor shows a trafficking profile distinct from that of any of the other dopamine receptors. PMID: 21348911
  18. These findings suggest that the conflicting findings obtained in association studies between ADRA2A polymorphisms and ADHD might be related to temperament profiles, and support additional studies addressing these effects in larger samples. PMID: 20864182
  19. The DRD5 expression in the temporal lobe of Alzheimer's disease patients is decressed. PMID: 20164562
  20. susceptibility loci for attention deficit disorder with hyperactivity at DRD5 PMID: 12660802
  21. these results suggest that there may be a functional variant of dopamine d5 receptor that conders susceptibility to developing focal dystonia in later life. PMID: 14509667
  22. There is no association of DRD5 polymorphism with ADHD. PMID: 14755441
  23. The ability of D5 receptor stimulation to decrease ROS production may explain, in part, the antihypertensive action of D5 receptor activation. PMID: 16352863
  24. Preferential transmission of paternal alleles at risk genes for ADHD is established. PMID: 16380908
  25. seven consecutive SNPs surrounding the D5 dopamine receptor gene (DRD5), were associated with the age at onset for attention deficit hyperactivity disorder PMID: 17501935
  26. Genetic analyses of dopamine related genes in adult ADHD patients suggest an association with the DRD5-microsatellite repeat, but not with DRD4 or SLC6A3 VNTRs. PMID: 18081165
  27. DRD5 (CA)(n) repeat has a modest effect in modulating susceptibility to adult attention deficit hyperactivity disorder PMID: 18164132
  28. Dopamine 5 receptor mediates Ang II type 1 receptor degradation via a ubiquitin-proteasome pathway in mice and human cells PMID: 18464932
  29. DRD5 protein is associated with ADHD. PMID: 18563476
  30. co-localizes with dopamine D2 receptor (together, they activate a calcium signal); a robust calcium signal is also seen with dopamine D5 alone. PMID: 19171671
  31. study reports the haplotype structure of the DRD5 coding region; analysis of the DRD5 coding region reveals two highly polymorphic SNPs in weak linkage disequilibrium and a low frequency of rare variants PMID: 19397556

Show More

Hide All

Involvement in disease
Benign essential blepharospasm (BEB)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Neuron-specific, localized primarily within limbic regions of the brain.
Database Links

HGNC: 3026

OMIM: 126453

KEGG: hsa:1816

STRING: 9606.ENSP00000306129

UniGene: Hs.380681

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1