Recombinant Human Diacylglycerol O-acyltransferase 1 (DGAT1)

Code CSB-CF006817HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
DGAT1
Uniprot No.
Alternative Names
DGAT1; AGRP1; DGAT; Diacylglycerol O-acyltransferase 1; ACAT-related gene product 1; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase
Species
Homo sapiens (Human)
Expression Region
1-488aa
Target Protein Sequence
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Highly expressed in epithelial cells of the small intestine and its activity is essential for the absorption of dietary fats. In liver, plays a role in esterifying exogenous fatty acids to glycerol, and is required to synthesize fat for storage. Also present in female mammary glands, where it produces fat in the milk. May be involved in VLDL (very low density lipoprotein) assembly. In contrast to DGAT2 it is not essential for survival. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders. Exhibits additional acyltransferase activities, includin acyl CoA:monoacylglycerol acyltransferase (MGAT), wax monoester and wax diester synthases. Also able to use 1-monoalkylglycerol (1-MAkG) as an acyl acceptor for the synthesis of monoalkyl-monoacylglycerol (MAMAG).
Gene References into Functions
  1. Study identified a large cohort of patients with congenital diarrheal disorders with mutations in DGAT1 that reduced expression of its product; dermal fibroblasts and intestinal organoids derived from these patients had altered lipid metabolism and were susceptible to lipid-induced cell death. Expression of full-length wildtype DGAT1 or DGAT2 restored normal lipid metabolism in these cells. PMID: 29604290
  2. our findings indicate that inhibition of both DGAT1 and ABHD5 using siRNA leads to reduction in prostate cancer cell growth. PMID: 28877685
  3. data reveal an important role for DGAT activity and TG synthesis generally in averting ER stress and lipotoxicity, with specifically DGAT1 performing this function during stimulated lipolysis in adipocytes. PMID: 28768178
  4. DGAT1 mutations result in a spectrum of diseases PMID: 28373485
  5. A novel homozygous missense variant was identified in a family with protein losing enteropathy. A splice site mutation in intron 8 was identified in a second family with PLE. These cases of DGAT1 deficiency extend the molecular and phenotypic spectrum of PLE. PMID: 26883093
  6. DGAT1 expression is down-regulated in viral hepatitis-related cirrhosis. PMID: 26493024
  7. Data indicate no clinically relevant pharmacokinetic interaction between DGAT-1 inhibitor pradigastat and rosuvastatin. PMID: 25740267
  8. the apparent lack of therapeutic window owing to GI side effects of AZD7687, particularly diarrhoea, makes the utility of DGAT1 inhibition as a novel treatment for diabetes and obesity questionable. PMID: 24118885
  9. Downregulation of CLDN1 was associated with altered fatty acid homeostasis in the absence of DGAT1. PMID: 24899196
  10. MGAT2 functions as a dimeric or tetrameric protein and selectively heterodimerizes with DGAT1 in mammalian cells PMID: 24573674
  11. The structure-activity relationship studies of a novel series of carboxylic acid derivatives of pyridine-carboxamides as DGAT-1 inhibitors is described. PMID: 23317570
  12. adipose overexpression of Dgat1 gene in transgenic mice leads to diet-inducible insulin resistance. PMID: 16306352
  13. Diacylglycerol acyltransferase-1 localizes hepatitis C virus NS5A protein to lipid droplets and enhances NS5A interaction with the viral capsid core PMID: 23420847
  14. results identify DGAT1 loss-of-function mutations as a rare cause of congenital diarrheal disorders PMID: 23114594
  15. describe distinct but synergistic roles of the two DGATs in an integrated pathway of TAG synthesis and secretion, with DGAT2 acting upstream of DGAT1 PMID: 22748069
  16. a comprehensive evaluation of a small molecule inhibitor for DGAT1 and suggests that pharmacological inhibition of DGAT1 holds promise in treating diverse metabolic disorders. PMID: 21990351
  17. DGAT1 belongs to the family of oligomeric membrane proteins that adopt a dual membrane topology. PMID: 21846726
  18. human small intestinal DGAT, which is mainly encoded by DGAT1, utilizes 1,2-DAG as the substrate to form TAG PMID: 21369919
  19. The triglyceride-synthesizing enzyme diacylglycerol acyltransferase-1 (DGAT1) is identified as a key host factor for hepatitis C virus infection. PMID: 20935628
  20. Identify DGAT1 as an important protein that participates in the effect of HNF4A on hepatic secretion of triglyceride-rich lipoproteins. PMID: 20167659
  21. Polymorphism associated with alterations in body mass index, high density lipoprotein levels and blood pressure in Turkish women. PMID: 12123490
  22. DGAT1 overexpression in murine white adipose tissue provides a model in which obesity does not impair glucose disposal PMID: 12401709
  23. DGAT participates in the regulation of membrane lipid synthesis and lipid signaling, thereby playing an important role in modulating cell growth properties PMID: 14557275
  24. Niacin selectively inhibited DGAT2 but not DGAT1 activity, but had no effect on the expression of DGAT1 and DGAT2 mRNA PMID: 15258194
  25. thiazolidinediones upregulate the adipocyte lipid storage genes DGAT and FAS but have no significant effect on LPL PMID: 16894240
  26. Review summarizes current knowledge of DGAT1 and DGAT2 enzymes, focusing on new advances since the cloning of their genes, including possible roles in human health and diseases. PMID: 18757836
  27. the acylation of acylglycerols by DGAT1 is important for dietary fat absorption in the intestine PMID: 18768481
  28. Report visceral and subcutaneous adipose tissue diacylglycerol acyltransferase activity in humans. PMID: 19197254

Show More

Hide All

Involvement in disease
Diarrhea 7 (DIAR7)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Database Links

HGNC: 2843

OMIM: 604900

KEGG: hsa:8694

STRING: 9606.ENSP00000332258

UniGene: Hs.521954

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×