Recombinant Human Diacylglycerol O-acyltransferase 1(DGAT1),partial

Code CSB-CF006817HU1
Product Type Transmembrane Protein
Size US$1653
Uniprot No. O75907
Relevance Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA
Research Area Cancer
Source in vitro E.coli expression system
Gene Names DGAT1
Protein Names ACAT-related gene product 1 Acyl-CoA retinol O-fatty-acyltransferase Short name:ARAT Short name: Retinol O-fatty-acyltransferase Diglyceride acyltransferase AGRP1, DGAT
Expression Region 240-488aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 37.1 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Involvement in disease Diarrhea 7 (DIAR7)
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Database Links

HGNC: 2843

OMIM: 604900

KEGG: hsa:8694

STRING: 9606.ENSP00000332258

UniGene: Hs.521954

Related Products

DGAT1 Antibodies

DGAT1 Antibodies for Homo sapiens (Human)

DGAT1 Proteins

DGAT1 Proteins for Homo sapiens (Human)

DGAT1 ELISA Kit

DGAT1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.